MCM2 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• MCM2 Monoclonal antibody (66204-1-Ig)

• Featured Product
• KD/KO Validated

MCM2 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66204-1-Ig Copied!

Clone No. 1F4D10

Publications (1)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA
For IF, select conjugated version.

Synonyms

1F4D10, BM28, CCNL1, CDCL1, EC:3.6.4.12

• 

  WB analysis using 66204-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66204-1-Ig (MCM2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 66204-1-Ig

  WB result of MCM2 antibody (66204-1-Ig; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-MCM2 transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A431 using 66204-1-Ig

  A431 cells were subjected to SDS PAGE followed by western blot with 66204-1-Ig (MCM2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of 4T1 using 66204-1-Ig

  4T1 cells were subjected to SDS PAGE followed by western blot with 66204-1-Ig (MCM2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 66204-1-Ig

  K-562 cells were subjected to SDS PAGE followed by western blot with 66204-1-Ig (MCM2 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 66204-1-Ig

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66204-1-Ig (MCM2 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of Human tonsillitis using 66204-1-Ig

  Immunohistochemical analysis of paraffin-embedded Human tonsillitis tissue slide using 66204-1-Ig (MCM2 antibody) at dilution of 1:2000 (under 20x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of Human tonsillitis using 66204-1-Ig

  Immunohistochemical analysis of paraffin-embedded Human tonsillitis tissue slide using 66204-1-Ig (MCM2 antibody) at dilution of 1:2000 (under 20x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 66204-1-Ig

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 66204-1-Ig (MCM2 Antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 66204-1-Ig

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 66204-1-Ig (MCM2 Antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MCM2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, K-562 cells, HEK-293 cells, A431 cells, 4T1 cells, A549 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells
• Positive IHC detected in: Human tonsillitis tissue, human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66204-1-Ig targets MCM2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0798

  Product name: Recombinant human MCM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 657-904 aa of BC007670

  Sequence: FDILCVVRDTVDPVQDEMLARFVVGSHVRHHPSNKEEEGLANGSAAEPAMPNTYGVEPLPQEVLKKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESMIRMAEAHARIHLRDYVIEDDVNMAIRVMLESFIDTQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLVAEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMILQQF

• Full Name: minichromosome maintenance complex component 2
• Calculated Molecular Weight: 102 kDa
• Observed Molecular Weight: 116-125 kDa
• GenBank Accession Number: BC007670
• Gene Symbol: MCM2
• Gene ID (NCBI): 4171
• RRID: AB_2881595
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P49736
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The MCM2 Monoclonal antibody (1F4D10), catalog number 66204-1-Ig, has 1 total citation. The cited publication appeared in Cell Death Discovery (2022) and investigated MCM2's role in promoting stemness and sorafenib resistance in hepatocellular carcinoma cells via Hippo signaling. The research field encompasses liver cancer biology, cancer stem cells, drug resistance mechanisms, and the Hippo signaling pathway.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Cell Death Discov; MCM2 promotes the stemness and sorafenib resistance of hepatocellular carcinoma cells via hippo signaling; Authors - Xin Zhou