MCM2 Recombinant monoclonal antibody

MCM2 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 84511-5-RR
Clone No.241968F7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

241968F7, BM28, CCNL1, CDCL1, EC:3.6.4.12

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, K-562 cells, Jurkat cells, NIH/3T3 cells, HSC-T6 cells, A431 cells
Positive IHC detected inhuman tonsillitis tissue, human cervical squamous cancer tissue, human colon cancer tissue, human placenta tissue, human skin tissue, mouse colon tissue, mouse small intestine tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84511-5-RR targets MCM2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0798

Product name: Recombinant human MCM2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 657-904 aa of BC007670

Sequence: FDILCVVRDTVDPVQDEMLARFVVGSHVRHHPSNKEEEGLANGSAAEPAMPNTYGVEPLPQEVLKKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESMIRMAEAHARIHLRDYVIEDDVNMAIRVMLESFIDTQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLVAEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMILQQF

Predict reactive species
Full Name minichromosome maintenance complex component 2
Calculated Molecular Weight 102 kDa
Observed Molecular Weight 116-125 kDa
GenBank Accession NumberBC007670
Gene Symbol MCM2
Gene ID (NCBI) 4171
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP49736
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The MCM2-7 complex forms the core of the replicative helicase which acts as the molecular motor that uses ATP binding and hydrolysis to fuel the unwinding of double-stranded DNA at the replication fork in eukaryotes. This complex is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. MCM2, also named CDCL1 and BM28, is a human nuclear protein that plays an important role in 2 crucial steps of the cell cycle, namely, onset of DNA replication and cell division.

Protocols

Product Specific Protocols
IF protocol for MCM2 antibody 84511-5-RRDownload protocol
IHC protocol for MCM2 antibody 84511-5-RRDownload protocol
WB protocol for MCM2 antibody 84511-5-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...