MCUR1 Polyclonal antibody

• 

  WB analysis of HEK-293 using 24948-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 24948-1-AP (MCUR1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 24948-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 24948-1-AP (MCUR1 antibody at dilution of 1:1000 incubated at 4 degree celsius over night.

• 

  IP experiment of HEK-293 using 24948-1-AP

  IP result of anti-MCUR1 (IP:24948-1-AP, 3ug; Detection:24948-1-AP 1:300) with HEK-293 cells lysate 920ug.

MCUR1 Polyclonal Antibody for WB, IP, ELISA

Cat No. 24948-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, ELISA

Synonyms

CCDC90A, MCU regulator 1, Coiled-coil domain-containing protein 90A, mitochondrial, C6orf79

---

Tested Applications

• Positive WB detected in: HEK-293 cells, mouse brain tissue
• Positive IP detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

24948-1-AP targets MCUR1 in WB, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20040

  Product name: Recombinant human CCDC90A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-223 aa of BC016850

  Sequence: MDCGSVGGQRTQRLPGRQRLLFLPVGLSGRPGGSETSARRCLSALSDGLGALRPRAPAARGGVSRASPLLLLLLVPSPRLAAAAPRRQLGDWERSRLGYAAPPAGRSSAWRCSPGVAAAAGALPQYHGPAPALVSCRRELSLSAGSLQLERKRRDFTSSGSRKLYFDTHALVCLLEDNGFATQQAEIIVSALVKILEANMDIVYKDMVTKMQQEITFQQVMSQ

• Full Name: coiled-coil domain containing 90A
• Calculated Molecular Weight: 359 aa, 40 kDa
• Observed Molecular Weight: 40-50 kDa
• GenBank Accession Number: BC016850
• Gene Symbol: MCUR1
• Gene ID (NCBI): 63933
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96AQ8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Physiol; Oxygen Glucose Deprivation Induced Prosurvival Autophagy Is Insufficient to Rescue Endothelial Function.; Authors - Venkateswaran Natarajan