CoraLite® Plus 488-conjugated MDC1 Recombinant monoclonal antibody

MDC1 Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra)
Cat No. CL488-83496
Clone No.240469D5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

NFBD1, NFBD 1, MDC 1, 240469D5

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83496 targets MDC1 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag20135

Product name: Recombinant human MDC1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-350 aa of BC152556

Sequence: MEDTQAIDWDVEEEEETEQSSESLRCNVEPVGRLHIFSGAHGPEKDFPLHLGKNVVGRMPDCSVALPFPSISKQHAEIEILAWDKAPILRDCGSLNGTQILRPPKVLSPGVSHRLRDQELILFADLLCQYHRLDVSLPFVSRGPLTVEETPRVQGETQPQRLLLAEDSEEEVDFLSERRMVKKSRTTSSSVIVPESDEEGHSPVLGGLGPPFAFNLNSDTDVEEGQQPATEEASSAARRGATVEAKQSEAEVVTEIQLEKDQPLVKERDNDTKVKRGAGNGVVPAGVILERSQPPGEDSDTDVDDDSRPPGRPAEVHLERAQPFGFIDSDTDAEEERIPATPVVIPMKKR

Predict reactive species
Full Name mediator of DNA damage checkpoint 1
Calculated Molecular Weight 2089 aa, 227 kDa
Observed Molecular Weight260-320 kDa
GenBank Accession NumberBC152556
Gene Symbol MDC1
Gene ID (NCBI) 9656
RRIDAB_3673259
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ14676
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

MDC1, also named as KIAA0170 or NFBD1, is a 2089 amino acid protein, which contains two BRCT domains and one FHA domain. MDC1 localizes in the nucleus and is highly expressed in testis. MDC1 is required for checkpoint mediated cell cycle arrest in response to DNA damage within both the S phase and G2/M phases of the cell cycle. MDC1 may serve as a scaffold for the recruitment of DNA repair and signal transduction proteins to discrete foci of DNA damage marked.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 MDC1 antibody CL488-83496Download protocol
IF protocol for CL Plus 488 MDC1 antibody CL488-83496Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...