MDH1 Monoclonal antibody, PBS Only

• 

  WB analysis using 66505-1-Ig (same clone as 66505-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66505-1-Ig (MDH1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66505-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 66505-1-Ig (same clone as 66505-1-PBS)

  WB result of MDH1 antibody (66505-1-Ig; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-MDH1 transfected HEK-293 cells. This data was developed using the same antibody clone with 66505-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 66505-1-Ig (same clone as 66505-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 66505-1-Ig (MDH1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66505-1-PBS in a different storage buffer formulation.

• 

  WB analysis of RAW 264.7 using 66505-1-Ig (same clone as 66505-1-PBS)

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 66505-1-Ig (MDH1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66505-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat heart using 66505-1-Ig (same clone as 66505-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 66505-1-Ig (MDH1 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66505-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat heart using 66505-1-Ig (same clone as 66505-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 66505-1-Ig (MDH1 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66505-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 66505-1-Ig (same clone as 66505-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using 66505-1-Ig (MDH1 antibody) at dilution of 1:100 and CoraLite488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66505-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HEK-293 using 66505-1-Ig (same clone as 66505-1-PBS)

  1X10^6 HEK-293 cells were intracellularly stained with 0.4 ug Anti-Human MDH1 (66505-1-Ig, Clone:1F9A2) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 66505-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MDH1 Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 66505-1-PBS

Clone No.1F9A2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

MDHA, KAR, EC:1.1.1.96, EC:1.1.1.37, Aromatic alpha-keto acid reductase

---

Product Information

66505-1-PBS targets MDH1 in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8744

  Product name: Recombinant human MDH1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-334 aa of BC001484

  Sequence: MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA

• Full Name: malate dehydrogenase 1, NAD (soluble)
• Calculated Molecular Weight: 334 aa, 36 kDa
• Observed Molecular Weight: 36-37 kDa
• GenBank Accession Number: BC001484
• Gene Symbol: MDH1
• Gene ID (NCBI): 4190
• RRID: AB_2881868
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P40925
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MDH1 (Malate dehydrogenase, cytoplasmic) is also named as MDHA and belongs to the LDH/MDH superfamily and MDH type 2 family which catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. It can exsit as a dimer and the dimeric MDH1 is the mitochondrial isoenzyme, whereas the tetrameric MDH2 is the glycosomal isoenzyme. (PMID:10693743)