MDH1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84576-4-RR (same clone as 84576-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84576-4-RR (MDH1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84576-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 84576-4-RR (same clone as 84576-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 84576-4-RR (MDH1 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84576-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 84576-4-RR (same clone as 84576-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 84576-4-RR (MDH1 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84576-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84576-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84576-4-RR against Human MDH1 were performed. The affinity constant is below 1 pM.

MDH1 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 84576-4-PBS

Clone No.241887A1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

MDHA, KAR, EC:1.1.1.96, EC:1.1.1.37, Aromatic alpha-keto acid reductase

---

Product Information

84576-4-PBS targets MDH1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag8744

  Product name: Recombinant human MDH1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-334 aa of BC001484

  Sequence: MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA

• Full Name: malate dehydrogenase 1, NAD (soluble)
• Calculated Molecular Weight: 334 aa, 36 kDa
• Observed Molecular Weight: 35-37 kDa
• GenBank Accession Number: BC001484
• Gene Symbol: MDH1
• Gene ID (NCBI): 4190
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P40925
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MDH1 (Malate dehydrogenase, cytoplasmic) is also named as MDHA and belongs to the LDH/MDH superfamily and MDH type 2 family which catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. It can exsit as a dimer and the dimeric MDH1 is the mitochondrial isoenzyme, whereas the tetrameric MDH2 is the glycosomal isoenzyme.(PMID:10693743)