MDH1 Recombinant monoclonal antibody

• 

  WB analysis using 84576-4-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84576-4-RR (MDH1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse heart using 84576-4-RR

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 84576-4-RR (MDH1 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 84576-4-RR

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 84576-4-RR (MDH1 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity and Kinetic Characterization of 84576-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84576-4-RR against Human MDH1 were performed. The affinity constant is below 1 pM.

MDH1 Recombinant Antibody for WB, IHC, ELISA

Cat No. 84576-4-RR

Clone No.241887A1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

MDHA, KAR, EC:1.1.1.96, EC:1.1.1.37, Aromatic alpha-keto acid reductase

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, HL-60 cells, mouse liver tissue, rat liver tissue, mouse kidney tissue, human kidney tissue
• Positive IHC detected in: mouse heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:300-1:1200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84576-4-RR targets MDH1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag8744

  Product name: Recombinant human MDH1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-334 aa of BC001484

  Sequence: MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA

• Full Name: malate dehydrogenase 1, NAD (soluble)
• Calculated Molecular Weight: 334 aa, 36 kDa
• Observed Molecular Weight: 35-37 kDa
• GenBank Accession Number: BC001484
• Gene Symbol: MDH1
• Gene ID (NCBI): 4190
• RRID: AB_3672076
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P40925
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MDH1 (Malate dehydrogenase, cytoplasmic) is also named as MDHA and belongs to the LDH/MDH superfamily and MDH type 2 family which catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. It can exsit as a dimer and the dimeric MDH1 is the mitochondrial isoenzyme, whereas the tetrameric MDH2 is the glycosomal isoenzyme.(PMID:10693743)