MDP-1 Polyclonal antibody

• 

  WB analysis of RAW 264.7 using 13929-1-AP

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 13929-1-AP (MDP-1 Antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 13929-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 13929-1-AP (MDP-1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 13929-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 13929-1-AP (MDP-1 Antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human liver using 13929-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 13929-1-AP (MDP-1 Antibody) at dilution of 1:100 (under 40x lens).

MDP-1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 13929-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

MDP 1, MDP1, MDP-1

---

Tested Applications

• Positive WB detected in: RAW 264.7 cells, HepG2 cells
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13929-1-AP targets MDP-1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4949

  Product name: Recombinant human MDP-1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-122 aa of BC046912

  Sequence: MARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQSLGVPGAAASRTSEIEGANQLLELFDLFRCYLHSHPEWNESSNSKSRVRDICEGPNWAFEVQP

• Full Name: magnesium-dependent phosphatase 1
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC046912
• Gene Symbol: MDP-1
• Gene ID (NCBI): 145553
• RRID: AB_2877989
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86V88
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.