ME2 Monoclonal antibody

• 

  WB analysis using 67457-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67457-1-Ig (ME2 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 67457-1-Ig

  WB result of ME2 antibody (67457-1-Ig; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ME2 transfected HeLa cells.

• 

  WB analysis of human peripheral blood platelets using 67457-1-Ig

  Human peripheral blood platelets were subjected to SDS PAGE followed by western blot with 67457-1-Ig (ME2 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 67457-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 67457-1-Ig (ME2 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 67457-1-Ig

  HepG2 cells were subjected to SDS PAGE followed by western blot with 67457-1-Ig (ME2 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 67457-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67457-1-Ig (ME2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 67457-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67457-1-Ig (ME2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 67457-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67457-1-Ig (ME2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 67457-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67457-1-Ig (ME2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

ME2 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67457-1-Ig

Clone No.6E6E2

Publications(1)

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Mouse, Rat and More (2)

Applications

WB, IF, IHC, ELISA

Synonyms

Malic enzyme 2, ME2, NAD ME

---

Tested Applications

• Positive WB detected in: LNCaP cells, HeLa cells, HepG2 cells, human peripheral blood platelets, K-562 cells, HSC-T6 cells, NIH/3T3 cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

67457-1-Ig targets ME2 in WB, IF, IHC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20741

  Product name: Recombinant human ME2 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 136-480 aa of BC000147

  Sequence: SISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGYRIPIC

• Full Name: malic enzyme 2, NAD(+)-dependent, mitochondrial
• Calculated Molecular Weight: 65 kDa
• Observed Molecular Weight: 54 kDa, 65 kDa
• GenBank Accession Number: BC000147
• Gene Symbol: ME2
• Gene ID (NCBI): 4200
• RRID: AB_2882689
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P23368
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ME2(malic enzyme 2) is also named as NAD-ME and belongs to the malic enzymes family. ME1, ME2 are important for NADPH production, lipogenesis and glutamine metabolism, but ME2 has a more profound effect. ME2 is a genome-coded mitochondrial enzyme that converts malate to pyruvate and is involved in neuronal synthesis of the neurotransmitter γ-aminobutyric acid (GABA)(PMID:15532013). This protein has 2 isoforms produced by alternative splicing with the MW of 65 kDa and 54 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	IHC,IF	Nat Commun; AKT1 phosphorylation of cytoplasmic ME2 induces a metabolic switch to glycolysis for tumorigenesis; Authors - Taiqi Chen