ME2 Monoclonal antibody, PBS Only

• 

  WB analysis using 67457-1-Ig (same clone as 67457-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67457-1-Ig (ME2 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67457-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 67457-1-Ig (same clone as 67457-1-PBS)

  WB result of ME2 antibody (67457-1-Ig; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ME2 transfected HeLa cells. This data was developed using the same antibody clone with 67457-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human peripheral blood platelets using 67457-1-Ig (same clone as 67457-1-PBS)

  Human peripheral blood platelets were subjected to SDS PAGE followed by western blot with 67457-1-Ig (ME2 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67457-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 67457-1-Ig (same clone as 67457-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 67457-1-Ig (ME2 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67457-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 67457-1-Ig (same clone as 67457-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 67457-1-Ig (ME2 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67457-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67457-1-Ig (same clone as 67457-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67457-1-Ig (ME2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67457-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67457-1-Ig (same clone as 67457-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67457-1-Ig (ME2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67457-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67457-1-Ig (same clone as 67457-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67457-1-Ig (ME2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67457-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 67457-1-Ig (same clone as 67457-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67457-1-Ig (ME2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67457-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ME2 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67457-1-PBS

Clone No.6E6E2

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Mouse, Rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Malic enzyme 2, ME2, NAD ME

---

Product Information

67457-1-PBS targets ME2 in WB, IHC, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20741

  Product name: Recombinant human ME2 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 136-480 aa of BC000147

  Sequence: SISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDIQGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLLVKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALSNPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGYRIPIC

• Full Name: malic enzyme 2, NAD(+)-dependent, mitochondrial
• Calculated Molecular Weight: 65 kDa
• Observed Molecular Weight: 54 kDa, 65 kDa
• GenBank Accession Number: BC000147
• Gene Symbol: ME2
• Gene ID (NCBI): 4200
• RRID: AB_2882689
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P23368
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ME2(malic enzyme 2) is also named as NAD-ME and belongs to the malic enzymes family. ME1, ME2 are important for NADPH production, lipogenesis and glutamine metabolism, but ME2 has a more profound effect. ME2 is a genome-coded mitochondrial enzyme that converts malate to pyruvate and is involved in neuronal synthesis of the neurotransmitter γ-aminobutyric acid (GABA)(PMID:15532013). This protein has 2 isoforms produced by alternative splicing with the MW of 65 kDa and 54 kDa.