MECR Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MECR Polyclonal antibody (14932-1-AP)

• Featured Product
• KD/KO Validated

MECR Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 14932-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

HsNrbf 1, FASN2B, Enoyl-[acyl-carrier-protein] reductase, mitochondrial, EC:1.3.1.104, CGI-63

• 

  WB analysis of mouse heart using 14932-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 14932-1-AP (MECR antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human stomach using 14932-1-AP

  human stomach tissue were subjected to SDS PAGE followed by western blot with 14932-1-AP (MECR antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 14932-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 14932-1-AP (MECR Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of C2C12 using 14932-1-AP

  Immunofluorescent analysis of (4% PFA) fixed C2C12 cells using MECR antibody (14932-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of LNCaP using 14932-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed LNCaP cells using 14932-1-AP (MECR antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MECR in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse heart tissue, human stomach tissue
• Positive IHC detected in: human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: C2C12 cells, LNCaP cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2400
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14932-1-AP targets MECR in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6738

  Product name: Recombinant human MECR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-373 aa of BC001419

  Sequence: MWVCSTLWRVRTPARQWRGLLPASGCHGPAASSYSASAEPARVRALVYGHHGDPAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGLLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQPGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM

• Full Name: mitochondrial trans-2-enoyl-CoA reductase
• Calculated Molecular Weight: 40 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC001419
• Gene Symbol: MECR
• Gene ID (NCBI): 51102
• RRID: AB_2235303
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BV79
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The MECR Polyclonal antibody (Cat# 14932-1-AP) has 1 citation to date. It was cited in PLOS Biology in a study investigating how alternative splicing generates a cryptic cytoplasmic isoform of mitochondrial MECR that antagonizes influenza virus infection. The cited application was Western blot in human, mouse, and pig samples. The research falls within the fields of virology and mitochondrial gene regulation.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse,pig	WB	PLoS Biol; Alternative splicing liberates a cryptic cytoplasmic isoform of mitochondrial MECR that antagonizes influenza virus; Authors - Steven F Baker ; KO Validated