Use Able AI chat for product recommendations

CoraLite® Plus 488-conjugated MECR Recombinant monoclonal antibody

MECR Uni-rAb® Recombinant Antibody for IF/ICC

Cat No. CL488-84729-4
Clone No.242151C5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

242151C5, 2-enoyl thioester reductase, EC:1.3.1.104, Enoyl-[acyl-carrier-protein] reductase, mitochondrial, Nrbf1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inC2C12 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:300-1:1200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84729-4 targets MECR in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0465

Product name: Recombinant mouse Mecr protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 117-373 aa of BC003864

Sequence: SSVSALKPGDWVIPANAGLGTWRTEAVFSEEALIGIPKDIPLQSAATLGVNPCTAYRMLVDFEQLQPGDSVIQNASNSGVGQAVIQIASALRLKTINVVRDRPDIKKLTDRLKDLGADYVLTEEELRMPETKTIFKDLPLPRLALNCVGGKSSTELLRHLAPGGTMVTYGGMAKQPVTASVSLLIFKDLKLRGFWLSQWKKNHSPDEFKELILTLCNLIRQGRLTAPSCSEVPLQGYQQALEASMKPFVSSKQILTM

Predict reactive species
Full Name mitochondrial trans-2-enoyl-CoA reductase
Calculated Molecular Weight 40 kDa
Observed Molecular Weight37-40 kDa
GenBank Accession NumberBC003864
Gene Symbol MECR
Gene ID (NCBI) 26922
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9DCS3
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Mitochondrial 2-enoyl-acyl-carrier protein reductase (MECR) is an enzyme in the mitochondrial fatty acid synthase (mtFAS) pathway. MECR is involved in the synthesis of lipoic acid and is required for mitochondrial respiratory competence. MECR is highly expressed in skeletal and heart muscles and exhibits lower expression in placenta, liver, kidney, and pancreas. It is weakly expressed or not expressed in the lung (PMID: 32440681, PMID: 37734847, PMID: 38296034).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 MECR antibody CL488-84729-4Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...