MED29 Polyclonal antibody

• 

  WB analysis using 33366-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33366-1-AP (MED29 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HT-29 using 33366-1-AP

  IP result of anti-MED29 (IP:33366-1-AP, 4ug; Detection:33366-1-AP 1:800) with HT-29 cells lysate 1760 ug.

• 

  IHC staining of human ovary cancer using 33366-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 33366-1-AP (MED29 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

MED29 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 33366-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, ELISA

Synonyms

Intersex-like protein, IXL, Mediator complex subunit 29, Mediator of RNA polymerase II transcription subunit 29

---

Tested Applications

• Positive WB detected in: HEK-293T cells, HT-29 cells
• Positive IP detected in: HT-29 cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33366-1-AP targets MED29 in WB, IHC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38949

  Product name: Recombinant human MED29 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-200 aa of NM_017592.2

  Sequence: MAASQQQASAASSAAGVSGPSSAGGPGPQQQPQPPAQLVGPAQSGLLQQQQQDFDPVQRYKMLIPQLKESLQTLMKVAAQNLIQNTNIDNGQKSSDGPIQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQISCAKDIHTALLDCANKVTGKTPAPPAGPGGTL

• Full Name: mediator complex subunit 29
• Calculated Molecular Weight: 21kDa，200aa
• Observed Molecular Weight: 21-25 kDa
• GenBank Accession Number: NM_017592.2
• Gene Symbol: MED29
• Gene ID (NCBI): 55588
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9NX70
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Mediator of RNA polymerase II transcription subunit 29 (MED29) is also named as Mediator complex subunit 29 and Intersex-like protein (IXL). MED29 is one of the most highly conserved proteins across species and is widely expressed in humans both during embryonic development and in adult tissues (PMID: 15555573). MED29 was overexpressed in pancreatic cancer and promoted pancreatic cancer cell viability (PMID: 21225629, PMID: 17332321). MED29 facilitated the epithelial-mesenchymal transition process in OSCC, thereby promoting migration and invasion (PMID: 39462350).