MED29 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MED29 Polyclonal antibody, PBS Only (33366-1-PBS)

• 

  WB analysis using 33366-1-AP (same clone as 33366-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33366-1-AP (MED29 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33366-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HT-29 using 33366-1-AP (same clone as 33366-1-PBS)

  IP result of anti-MED29 (IP:33366-1-AP, 4ug; Detection:33366-1-AP 1:800) with HT-29 cells lysate 1760 ug. This data was developed using the same antibody clone with 33366-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 33366-1-AP (same clone as 33366-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 33366-1-AP (MED29 antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 33366-1-PBS in a different storage buffer formulation.

MED29 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 33366-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

Intersex-like protein, IXL, Mediator complex subunit 29, Mediator of RNA polymerase II transcription subunit 29

---

Product Information

33366-1-PBS targets MED29 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38949

  Product name: Recombinant human MED29 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-200 aa of NM_017592.2

  Sequence: MAASQQQASAASSAAGVSGPSSAGGPGPQQQPQPPAQLVGPAQSGLLQQQQQDFDPVQRYKMLIPQLKESLQTLMKVAAQNLIQNTNIDNGQKSSDGPIQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQISCAKDIHTALLDCANKVTGKTPAPPAGPGGTL

• Full Name: mediator complex subunit 29
• Calculated Molecular Weight: 21kDa，200aa
• Observed Molecular Weight: 21-25 kDa
• GenBank Accession Number: NM_017592.2
• Gene Symbol: MED29
• Gene ID (NCBI): 55588
• RRID: AB_3742951
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9NX70
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Mediator of RNA polymerase II transcription subunit 29 (MED29) is also named as Mediator complex subunit 29 and Intersex-like protein (IXL). MED29 is one of the most highly conserved proteins across species and is widely expressed in humans both during embryonic development and in adult tissues (PMID: 15555573). MED29 was overexpressed in pancreatic cancer and promoted pancreatic cancer cell viability (PMID: 21225629, PMID: 17332321). MED29 facilitated the epithelial-mesenchymal transition process in OSCC, thereby promoting migration and invasion (PMID: 39462350).