MED30 Monoclonal antibody, PBS Only (Detector)

• 

  WB analysis using 67038-1-Ig (same clone as 67038-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67038-1-Ig (MED30 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67038-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 67038-1-Ig (same clone as 67038-1-PBS)

  WB result of MED30 antibody (67038-1-Ig; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-MED30 transfected HEK-293 cells. This data was developed using the same antibody clone with 67038-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig brain using 67038-1-Ig (same clone as 67038-1-PBS)

  pig brain tissue were subjected to SDS PAGE followed by western blot with 67038-1-Ig (MED30 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67038-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 67038-1-Ig (same clone as 67038-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 67038-1-Ig (MED30 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67038-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP51523-1

  Cytometric bead array sample test of MP51523-1, MED30 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67038-2-PBS. Detection antibody: 67038-1-PBS.

• 

  Cytometric bead array standard curve of MP51523-1

  Cytometric bead array standard curve of MP51523-1, MED30 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67038-2-PBS. Detection antibody: 67038-1-PBS. Standard:Ag10235. Range: 0.391-50 ng/mL.

• Featured Product
• KD/KO Validated

MED30 Monoclonal Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 67038-1-PBS

Clone No.1D7C4

Host / Isotype

Mouse / IgG2a

Reactivity

human, rat, pig

Applications

WB, Cytometric bead array, Indirect ELISA

Synonyms

1D7C4, Mediator complex subunit 30, Mediator of RNA polymerase II transcription subunit 30, THRAP6, Thyroid hormone receptor-associated protein 6

---

Product Information

67038-1-PBS targets MED30 as part of a matched antibody pair:

MP51523-1: 67038-2-PBS capture and 67038-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, rat, pig
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10235

  Product name: Recombinant human MED30 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-178 aa of BC008226

  Sequence: MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRLTKLQDNLRQLSVLFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEEDGSKNDDRAGPPRFASEERREIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN

• Full Name: mediator complex subunit 30
• Calculated Molecular Weight: 178 aa, 20 kDa
• Observed Molecular Weight: 20-25 kDa
• GenBank Accession Number: BC008226
• Gene Symbol: MED30
• Gene ID (NCBI): 90390
• RRID: AB_2882352
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96HR3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MED30, also named as THRAP6 and TRAP25, is a component of the Mediator complex. MED30 has two isoforms with MW 16-20 kDa ad 20-25 kDa.