MED30 Monoclonal antibody, PBS Only

• 

  WB analysis using 67038-1-Ig (same clone as 67038-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67038-1-Ig (MED30 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67038-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 67038-1-Ig (same clone as 67038-1-PBS)

  WB result of MED30 antibody (67038-1-Ig; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-MED30 transfected HEK-293 cells. This data was developed using the same antibody clone with 67038-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig brain using 67038-1-Ig (same clone as 67038-1-PBS)

  pig brain tissue were subjected to SDS PAGE followed by western blot with 67038-1-Ig (MED30 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67038-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 67038-1-Ig (same clone as 67038-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 67038-1-Ig (MED30 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67038-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MED30 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67038-1-PBS

Clone No.1D7C4

Host / Isotype

Mouse / IgG2a

Reactivity

Human, rat, pig

Applications

WB, Indirect ELISA

Synonyms

MED30, mediator complex subunit 30, THRAP6, TRAP25

---

Product Information

67038-1-PBS targets MED30 in WB, Indirect ELISA applications and shows reactivity with Human, rat, pig samples.

• Tested Reactivity: Human, rat, pig
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10235

  Product name: Recombinant human MED30 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-178 aa of BC008226

  Sequence: MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRLTKLQDNLRQLSVLFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEEDGSKNDDRAGPPRFASEERREIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN

• Full Name: mediator complex subunit 30
• Calculated Molecular Weight: 178 aa, 20 kDa
• Observed Molecular Weight: 20-25 kDa
• GenBank Accession Number: BC008226
• Gene Symbol: MED30
• Gene ID (NCBI): 90390
• RRID: AB_2882352
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96HR3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MED30, also named as THRAP6 and TRAP25, is a component of the Mediator complex. MED30 has two isoforms with MW 16-20 kDa ad 20-25 kDa.