MED30 Monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA sample test of MP51523-2

  The mean MED30 concentration was determined to be 125.2 ng/mL in Ramos cell extract based on a 2.3 mg/mL extract load, 25.5 ng/mL in A549 cell extract based on a 1.2 mg/mL extract load and 21.9 ng/mL in HeLa cell extract based on a 1.2 mg/mL extract load.

• 

  Sandwich ELISA standard curve of MP51523-2

  Sandwich ELISA standard curve of MP51523-2, Human MED30 Monoclonal Matched Antibody Pair - PBS only. 67038-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag10235. 67038-3-PBS was HRP conjugated as the detection antibody. Range: 156-5000 pg/mL.

• 

  Cytometric bead array sample test of MP51523-1

  Cytometric bead array sample test of MP51523-1, MED30 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67038-2-PBS. Detection antibody: 67038-1-PBS.

• 

  Cytometric bead array sample test of MP51523-2

  Cytometric bead array sample test of MP51523-2, MED30 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67038-2-PBS. Detection antibody: 67038-3-PBS.

• 

  Cytometric bead array standard curve of MP51523-1

  Cytometric bead array standard curve of MP51523-1, MED30 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67038-2-PBS. Detection antibody: 67038-1-PBS. Standard:Ag10235. Range: 0.391-50 ng/mL.

• 

  Cytometric bead array standard curve of MP51523-2

  Cytometric bead array standard curve of MP51523-2, MED30 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67038-2-PBS. Detection antibody: 67038-3-PBS. Standard:Ag10235. Range: 0.391-50 ng/mL.

MED30 Monoclonal Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 67038-2-PBS

Clone No.3E4A7

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA

Synonyms

---

Product Information

67038-2-PBS targets MED30 as part of a matched antibody pair:

MP51523-1: 67038-2-PBS capture and 67038-1-PBS detection (validated in Cytometric bead array)

MP51523-2: 67038-2-PBS capture and 67038-3-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10235

  Product name: Recombinant human MED30 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-178 aa of BC008226

  Sequence: MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRLTKLQDNLRQLSVLFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEEDGSKNDDRAGPPRFASEERREIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN

• Full Name: mediator complex subunit 30
• Calculated Molecular Weight: 178 aa, 20 kDa
• GenBank Accession Number: BC008226
• Gene Symbol: MED30
• Gene ID (NCBI): 90390
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q96HR3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.