CoraLite®594-conjugated MED4 Monoclonal antibody

MED4 Monoclonal Antibody for FC (Intra)
Cat No. CL594-67839
Clone No.2E6F4

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Mouse, rat

Applications

FC (Intra)

MED4, Mediator of RNA polymerase II transcription subunit 4, TRAP36, VDRIP, Vitamin D3 receptor-interacting protein complex 36 kDa component, 2E6F4, Activator-recruited cofactor 36 kDa component, ARC36, DRIP36, HSPC126

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHepG2 cells
Positive FC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
Flow Cytometry (FC)FC : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67839 targets MED4 in FC (Intra) applications and shows reactivity with Human, Mouse, rat samples.

Tested Reactivity Human, Mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8562

Product name: Recombinant human MED4 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-270 aa of BC005189

Sequence: MAASSSGEKEKERLGGGLGVAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDGDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKEDEDDVEIMSTDSSSSSSESD

Predict reactive species
Full Name mediator complex subunit 4
Calculated Molecular Weight 270 aa, 30 kDa
Observed Molecular Weight~36 kDa
GenBank Accession NumberBC005189
Gene Symbol MED4
Gene ID (NCBI) 29079
RRIDAB_2934780
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NPJ6
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

MED4 is a component of the Meditor complex, which is a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Meditor functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. It also have an alternative name called "Activator-recruited cofactor 36 kDa component (ARC36) ".

Protocols

Product Specific Protocols
FC protocol for CL594 MED4 antibody CL594-67839Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...