MED7 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MED7 Polyclonal antibody, PBS Only (33458-1-PBS)

• 

  WB analysis using 33458-1-AP (same clone as 33458-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 33458-1-AP (MED7 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 33458-1-PBS in a different storage buffer formulation.

MED7 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 33458-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Mediator complex subunit 7, Activator-recruited cofactor 34 kDa component, ARC34, Cofactor required for Sp1 transcriptional activation subunit 9, CRSP complex subunit 9

---

Product Information

33458-1-PBS targets MED7 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38214

  Product name: Recombinant human MED7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-233 aa of BC006968

  Sequence: MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGHRRDQIIEKDAALCVLIDEMNERP

• Full Name: mediator complex subunit 7
• Calculated Molecular Weight: 233 aa, 27 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC006968
• Gene Symbol: MED7
• Gene ID (NCBI): 9443
• RRID: AB_3742979
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O43513
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MED7 is a crucial subunit of the Mediator complex, a protein complex that regulates gene transcription by interacting with RNA polymerase II.