MEGF8 Polyclonal antibody

• 

  WB analysis using 32300-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32300-1-AP (MEGF8 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

MEGF8 Polyclonal Antibody for WB, ELISA

Cat No. 32300-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Multiple EGF-like domains protein 8, KIAA0817, Epidermal growth factor-like protein 4, EGF-like protein 4, EGFL4

---

Tested Applications

• Positive WB detected in: COLO 320 cells, HepG2 cells, U-251 cells, U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32300-1-AP targets MEGF8 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36469

  Product name: Recombinant human MEGF8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2442-2647 aa of NM_001271938.1

  Sequence: YRLISVEQECCLDPTSQTNCFHEPKRRALGPGRTVLFGVQPKFTNVDIRLTLDVTFGAVDLYVSTSYDTFVVRVAPDTGVHTVHIQPPPAPPPPPPPADGGPRGAGDPGGAGASSGPGAPAEPRVREVWPRGLITYVTVTEPSAVLVVRGVRDRLVITYPHEHHALKSSRFYLLLLGVGDPSGPGANGSADSQGLLFFRQDQAHID

• Full Name: multiple EGF-like-domains 8
• Calculated Molecular Weight: 303 kDa
• Observed Molecular Weight: 303 kDa
• GenBank Accession Number: NM_001271938.1
• Gene Symbol: MEGF8
• Gene ID (NCBI): 1954
• RRID: AB_3670233
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q7Z7M0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Multiple epidermal growth factor-like domains protein 8 (MEGF8, also known as C19orf49, EGFL4, and KIAA0817) is a multidomain transmembrane protein, which is known to interact with MGRN1, a protein that functions as an E3 ubiquitin ligase, and this interaction is involved in the regulation of Hedgehog signaling and heart development (PMID: 32966817). It is also involved in mediating Bone morphogenetic protein 4 (BMP4) signaling and guidance of developing trigeminal ganglion (TG) axons (PMID: 24052814). Immunoelectron microscopy showed that MEGF8 was present in the synapses and around the outer mitochondrial membrane, indicating its role in synaptic and mitochondrial functions (PMID: 38201267).