MEIKIN Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MEIKIN Polyclonal antibody, PBS Only (31759-1-PBS)

• 

  IHC staining of human placenta using 31759-1-AP (same clone as 31759-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 31759-1-AP (MEIKIN antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31759-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse testis using 31759-1-AP (same clone as 31759-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse testis tissue using MEIKIN antibody (31759-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31759-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MDCK using 31759-1-AP (same clone as 31759-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed MDCK cells using MEIKIN antibody (31759-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 31759-1-PBS in a different storage buffer formulation.

MEIKIN Polyclonal Antibody for IHC, IF/ICC, IF-P, Indirect ELISA

Cat No. 31759-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, IF-P, Indirect ELISA

Synonyms

LOC728637, similar to mCG13783

---

Product Information

31759-1-PBS targets MEIKIN in IHC, IF/ICC, IF-P, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36937

  Product name: Recombinant human MEIKIN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-113 aa of NM_001303622

  Sequence: MWPLRVYTRKKREGQRLNLTPTPDLGSPAKAEAPPGSKRKGKVHGLSKIAEKAERSRQGGSGSGPFSPRLGVTGEKSLQENRSSEDTQDEKIASLRESVTDDLQVDSSSSNSE

• Full Name: similar to mCG13783
• Calculated Molecular Weight: 373aa, 41 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: NM_001303622
• Gene Symbol: LOC728637
• Gene ID (NCBI): 728637
• RRID: AB_3742474
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: A0A087WXM9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Meikin is a conservative regulatory protein that plays a key role in meiosis. It was first discovered in mice. It is a meiotic-specific centromere protein and was named Meikin because of its important role in meiosis. Meikin's function is mainly realized by regulating the activity of Polo-like kinase PLK1. PLK1 is enriched to centromere under Meikin's dependence, which further affects the function of centromere.