MEKK3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MEKK3 Polyclonal antibody, PBS Only (21072-1-PBS)

• 

  WB analysis of mouse liver using 21072-1-AP (same clone as 21072-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 21072-1-AP (MEKK3 antibody at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21072-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse liver using 21072-1-AP (same clone as 21072-1-PBS)

  IP result of anti-MEKK3 (IP:21072-1-AP, 4ug; Detection:21072-1-AP 1:300) with mouse liver tissue lysate 7000ug. This data was developed using the same antibody clone with 21072-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 21072-1-AP (same clone as 21072-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 21072-1-AP (MEKK3 antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21072-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 21072-1-AP (same clone as 21072-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 21072-1-AP (MEKK3 antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21072-1-PBS in a different storage buffer formulation.

MEKK3 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 21072-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

21072-1-PBS targets MEKK3 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15223

  Product name: Recombinant human MAP3K3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 281-366 aa of BC090859

  Sequence: VSVHHKDYSDGRRTFPRIRRHQGNLFTLVPSSRSLSTNGENMGLAVQYLDPRGRLRSADSENALSVQERNVPTKSPSAPINWRRGK

• Full Name: mitogen-activated protein kinase kinase kinase 3
• Calculated Molecular Weight: 657 aa, 74 kDa
• Observed Molecular Weight: 71 kDa, 74 kDa
• GenBank Accession Number: BC090859
• Gene Symbol: MEKK3
• Gene ID (NCBI): 4215
• RRID: AB_2878806
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99759
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The mitogen-activated protein/ERK kinase kinase 3 (MEKK3) is a member of a family of MEKK/Ste11 serine/threonine protein kinases. One function of MEKK3 is to serve as an upstream regulatory kinase in the mitogen-activated protein kinase cascade, however, it also plays a critical role in other signaling pathways. MEKK3 regulates several important functions including cell survival and proliferation. It is ubiquitously expressed in multiple tissues and has been found in complexes with scaffold proteins and other kinases. (PMID: 18206350).Cerebral cavernous malformations (CCMs) complex regulation of MEKK3 is essential during vertebrate heart development. MEKK3 signalling and KLF2/4 may be targeted to develop new CCM therapeutics.