• Featured Product
  • KD/KO Validated

MELK Recombinant monoclonal antibody, PBS Only (Capture)

MELK Uni-rAb® Recombinant Antibody for WB, IHC, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 82893-2-PBS
Clone No.230106A4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

230106A4, EC:2.7.10.2, EC:2.7.11.1, hMELK, hPK38

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82893-2-PBS targets MELK as part of a matched antibody pair:

MP00075-4: 82893-2-PBS capture and 82893-6-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1897

Product name: Recombinant human MELK protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 302-651 aa of BC014039

Sequence: EDLISLWQYDHLTATYLLLLAKKARGKPVRLRLSSFSCGQASATPFTDIKSNNWSLEDVTASDKNYVAGLIDYDWCEDDLSTGAATPRTSQFTKYWTESNGVESKSLTPALCRTPANKLKNKENVYTPKSAVKNEEYFMFPEPKTPVNKNQHKREILTTPNRYTTPSKARNQCLKETPIKIPVNSTGTDKLMTGVISPERRCRSVELDLNQAHMEETPKRKGAKVFGSLERGLDKVITVLTRSKRKGSARDGPRRLKLHYNVTTTRLVNPDQLLNEIMSILPKKHVDFVQKGYTLKCQTQSDFGKVTMQFELEVCQLQKPDVVGIRRQRLKGDAWVYKRLVEDILSSCKV

Predict reactive species
Full Name maternal embryonic leucine zipper kinase
Calculated Molecular Weight 651 aa, 75 kDa
Observed Molecular Weight50-70 kDa
GenBank Accession NumberBC014039
Gene Symbol MELK
Gene ID (NCBI) 9833
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ14680
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

MELK is involved in various processes such as cell cycle regulation, self-renewal of stem cells, apoptosis and splicing regulation. It also plays a key role in cell proliferation and carcinogenesis, and it is required for proliferation of embryonic and postnatal multipotent neural progenitors.

Loading...
||
New chat Able
正在加载,请稍候...