MEPCE Polyclonal antibody

• 

  WB analysis of MCF-7 using 11526-1-AP

  WB result of MEPCE antibody (11526-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-MEPCE transfected MCF-7 cells.

• 

  WB analysis of HeLa using 11526-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11526-1-AP (MEPCE Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 11526-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 11526-1-AP (MEPCE Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 11526-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 11526-1-AP (MEPCE antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 11526-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 11526-1-AP (MEPCE antibody) at dilution of 1:50 (under 10x lens).

• Featured Product
• KD/KO Validated

MEPCE Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11526-1-AP

Publications(4)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IP, IHC, ELISA

Synonyms

Bin3 homolog, MEPCE, methylphosphate capping enzyme

---

Tested Applications

• Positive WB detected in: HeLa cells, MCF-7 cells, K-562 cells
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below
• IP: See 1 publications below

Product Information

11526-1-AP targets MEPCE in WB, IP, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2092

  Product name: Recombinant human MEPCE protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 369-689 aa of BC018935

  Sequence: SSKSEAGARGGGQGSKEKGRGSWGGRHHHHHPLPAAGFKKQQRKFQYGNYCKYYGYRNPSCEDGRLRVLKPEWFRGRDVLDLGCNVGHLTLSIACKWGPSRMVGLDIDSRLIHSARQNIRHYLSEELRLPPQTLEGDPGAEGEEGTTTVRKRSCFPASLTASRGPIAAPQVPLDGADTSVFPNNVVFVTGNYVLDRDDLVEAQTPEYDVVLCLSLTKWVHLNWGDEGLKRMFRRIYRHLRPGGILVLEPQPWSSYGKRKTLTETIYKNYYRIQLKPEQFSSYLTSPDVGFSSYELVATPHNTSKGFQRPVYLFHKARSPSH

• Full Name: methylphosphate capping enzyme
• Calculated Molecular Weight: 689 aa, 74 kDa
• Observed Molecular Weight: 74 kDa
• GenBank Accession Number: BC018935
• Gene Symbol: MEPCE
• Gene ID (NCBI): 56257
• RRID: AB_2143568
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7L2J0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MEPCE is a Component of the 7SK snRNP complex, and a S-adenosyl-L-methionine-dependent methyltransferase that adds a methylphosphate cap at the 5'-end of 7SK snRNA, which leads to its stabilization.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Dev Cell; Calpain 2 activation of P-TEFb drives megakaryocyte morphogenesis and is disrupted by leukemogenic GATA1 mutation.; Authors - Kamaleldin E Elagib
zebrafish	WB,IP	Proc Natl Acad Sci U S A; 7SK snRNP/P-TEFb couples transcription elongation with alternative splicing and is essential for vertebrate development.; Authors - Barboric Matjaz M
human	WB	Nucleic Acids Res; 7SK small nuclear RNA directly affects HMGA1 function in transcription regulation.; Authors - Eilebrecht Sebastian S
human	WB	RNA Biol; 7SK snRNA-mediated, gene-specific cooperativity of HMGA1 and P-TEFb.; Authors - Eilebrecht Sebastian S

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

MIAO (Verified Customer) (09-17-2020)

good Ab with nice WB signal

• Applications: Western Blot
• Primary Antibody Dilution: 1:1K
• Cell Tissue Type: HCT cell