METTL16 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• METTL16 Polyclonal antibody (19924-1-AP)

• Featured Product
• KD/KO Validated

METTL16 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 19924-1-AP Copied!

Publications (38)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, rat, mouse

Applications

WB, IHC, IF, RIP, ELISA

Synonyms

METT10D, METTL16

• 

  WB analysis using 19924-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 19924-1-AP (METTL16 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat testis using 19924-1-AP

  rat testis tissue were subjected to SDS PAGE followed by western blot with 19924-1-AP (METTL16 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 19924-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon using 19924-1-AP (METT10D antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 19924-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 19924-1-AP (METTL16 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 19924-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 19924-1-AP (METTL16 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 19924-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 19924-1-AP (METTL16 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for METTL16 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, rat testis tissue, NCI-H1299 cells, NIH/3T3 cells, mouse testis tissue
• Positive IHC detected in: human colon tissue, mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

19924-1-AP targets METTL16 in WB, IHC, IF, RIP, ELISA applications and shows reactivity with human, rat, mouse samples.

• Tested Reactivity: human, rat, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13889

  Product name: Recombinant human METT10D protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-213 aa of BC001213

  Sequence: MALSKSMHARNRYKDKPPDFAYLASKYPDFKQHVQINLNGRVSLNFKDPEAVRALTCTLLREDFGLSIDIPLERLIPTVPLRLNYIHWVEDLIGHQDSDKSTLRRGIDIGTGASCIYPLLGATLNGWYFLATEVDDMCFNYAKKNVEQNNLSDLIKVVKVPQKTLLMDALKEESEIIYDFCMCNPPFFANQLEAKGVNSRNPRRPPPSSVNTG

• Full Name: methyltransferase 10 domain containing
• Calculated Molecular Weight: 562 aa, 64 kDa
• Observed Molecular Weight: 70-75 kDa
• GenBank Accession Number: BC001213
• Gene Symbol: METTL16
• Gene ID (NCBI): 79066
• RRID: AB_10639364
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86W50
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Methyltransferase-like protein 16 (METTL16) is a human RNA methyltransferase that installs m6A marks on U6 small nuclear RNA (U6 snRNA) and S-adenosylmethionine (SAM) synthetase pre-mRNA. METTL16 is considered a protective gene, suppressing the development of OC, HCC, and endocrine system tumors (PMID: 33237039, PMID: 33133142, PMID: 34187307). However, the high expression of METTL16 has been linked with a poor survival rate in patients with breast cancer (PMID: 33362863). METTL16 has 2 isoforms with molecular weights of 64 and 26 kDa.

Publications

What published studies show

Anti-METTL16 (Cat# 19924-1-AP) has accumulated 38 citations across journals including Molecular Cell, Developmental Cell, Cell Reports, Advanced Science, Journal of Biological Chemistry, Clinical and Translational Medicine, Communications Biology, International Journal of Biological Sciences, BMC Cancer, Frontiers in Genetics, and Biochemical and Biophysical Research Communications. Associated research fields include m6A RNA methylation, multiple cancer types (breast, ovarian, colorectal, pancreatic, lung, hepatic), ferroptosis, diabetes, osteoporosis, and cardiovascular disease.

Automatically generated from the 38 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; A lncRNA from the FTO locus acts as a suppressor of the m6A writer complex and p53 tumor suppression signaling; Authors - Jianong Zhang
human	WB	Genes Dis; Targeting METTL3 protein by proteolysis-targeting chimeras: A novel therapeutic approach for acute myeloid leukemia; Authors - Rukiye Nar
human	WB	Adv Sci (Weinh); HDAC2-Mediated METTL3 Delactylation Promotes DNA Damage Repair and Chemotherapy Resistance in Triple-Negative Breast Cancer; Authors - Xiaoniu He
human	WB,IHC	Cell Mol Biol Lett; The cancer-testis lncRNA LINC01940 promotes gastric cancer malignant progression and chemoresistance by enhancing ribosome biogenesis via TAF15-mediated NOL11 SUMOylation.; Authors - Weijie Zang
	IHC	Int J Biol Sci; METTL16 Promotes Lipid Metabolic Reprogramming and Colorectal Cancer Progression; Authors - Jie Li
human	WB	Cell Death Discov; Silencing of METTL16 protects granulosa cells from the cisplatin-induced ferroptosis in premature ovarian failure.; Authors - Jing Xiong ; KD Validated