METTL16 Polyclonal antibody

• 

  WB analysis using 19924-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 19924-1-AP (METTL16 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat testis using 19924-1-AP

  rat testis tissue were subjected to SDS PAGE followed by western blot with 19924-1-AP (METTL16 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon using 19924-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon using 19924-1-AP (METT10D antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human colon using 19924-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 19924-1-AP (METTL16 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 19924-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 19924-1-AP (METTL16 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 19924-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 19924-1-AP (METTL16 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

METTL16 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 19924-1-AP

Publications(22)

Host / Isotype

Rabbit / IgG

Reactivity

human, rat, mouse

Applications

WB, IHC, IF, ELISA

Synonyms

METT10D, METTL16

---

Tested Applications

• Positive WB detected in: HeLa cells, rat testis tissue, NCI-H1299 cells, NIH/3T3 cells, mouse testis tissue
• Positive IHC detected in: human colon tissue, mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 19 publications below
• IHC: See 7 publications below
• IF: See 2 publications below

Product Information

19924-1-AP targets METTL16 in WB, IHC, IF, ELISA applications and shows reactivity with human, rat, mouse samples.

• Tested Reactivity: human, rat, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13889

  Product name: Recombinant human METT10D protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-213 aa of BC001213

  Sequence: MALSKSMHARNRYKDKPPDFAYLASKYPDFKQHVQINLNGRVSLNFKDPEAVRALTCTLLREDFGLSIDIPLERLIPTVPLRLNYIHWVEDLIGHQDSDKSTLRRGIDIGTGASCIYPLLGATLNGWYFLATEVDDMCFNYAKKNVEQNNLSDLIKVVKVPQKTLLMDALKEESEIIYDFCMCNPPFFANQLEAKGVNSRNPRRPPPSSVNTG

• Full Name: methyltransferase 10 domain containing
• Calculated Molecular Weight: 562 aa, 64 kDa
• Observed Molecular Weight: 70-75 kDa
• GenBank Accession Number: BC001213
• Gene Symbol: METTL16
• Gene ID (NCBI): 79066
• RRID: AB_10639364
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86W50
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Methyltransferase-like protein 16 (METTL16) is a human RNA methyltransferase that installs m6A marks on U6 small nuclear RNA (U6 snRNA) and S-adenosylmethionine (SAM) synthetase pre-mRNA. METTL16 is considered a protective gene, suppressing the development of OC, HCC, and endocrine system tumors (PMID: 33237039, PMID: 33133142, PMID: 34187307). However, the high expression of METTL16 has been linked with a poor survival rate in patients with breast cancer (PMID: 33362863). METTL16 has 2 isoforms with molecular weights of 64 and 26 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Dev Cell; PDGF signaling inhibits mitophagy in glioblastoma stem cells through N6-methyladenosine.; Authors - Deguan Lv
human	WB	Cell Rep; LINC00921 reduces lung cancer radiosensitivity by destabilizing NUDT21 and driving aberrant MED23 alternative polyadenylation; Authors - Nasha Zhang
human	WB	Oxid Med Cell Longev; Methylation Pattern Mediated by m6A Regulator and Tumor Microenvironment Invasion in Lung Adenocarcinoma.; Authors - Feng Jiang
human	WB	J Biol Chem; m6A demethylation of cytidine deaminase APOBEC3B mRNA orchestrates arsenic-induced mutagenesis.; Authors - Ming Gao
human	WB,IHC	Anal Cell Pathol (Amst); METTL16 Inhibits the Malignant Progression of Epithelial Ovarian Cancer through the lncRNA MALAT1/β-Catenin Axis; Authors - Changshu Li ; KD Validated
human	IHC	J Coll Physicians Surg Pak; Clinical Significance of Methyltransferase-like 16 Expression in Epithelial Ovarian Cancer; Authors - Changshu Li