METTL10 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• METTL10 Polyclonal antibody (33763-1-AP)

• 

  WB analysis using 33763-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33763-1-AP (METTL10 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 33763-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 33763-1-AP (METTL10 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 33763-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using METTL10 antibody (33763-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

METTL10 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 33763-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

C10orf138, EEF1AKMT2

---

Tested Applications

• Positive WB detected in: A431 cells, DU 145 cells, Daudi cells, Raji cells
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:200-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33763-1-AP targets METTL10 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37000

  Product name: Recombinant human METTL10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-192 aa of BC026167

  Sequence: MSSGADGGGGAAVAARSDKGSPGEDGFVPSALGTREHWDAVYERELQTFREYGDTGEIWFGEESMNRLIRWMQKHKIPLDASVLDIGTGNGVFLVELAKFGFSNITGIDYSPSAIQLSGSIIEKEGLSNIKLKVEDFLNLSTQLSGFHICIDKGTFDAISLNPDNAIEKRKQYVKSLSRVLKVKGFFSNNVM

• Full Name: methyltransferase like 10
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC026167
• Gene Symbol: METTL10
• Gene ID (NCBI): 399818
• RRID: AB_3743071
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q5JPI9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Methyltransferase-like 10 (METTL10) is a lysine trimethyltransferase targeting eukaryotic translation elongation factor 1A1 (eEF1A1), which is well preserved from simple eukaryotes such as Saccharomyces cerevisiae to mammals such as humans and mice. Recently, METTL10was identified as an estimated glomerular filtration rate (eGFR)-associated gene through a transethnic genome-wide association study of eGFR. (PMID: 39774961)