METTL13 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• METTL13 Polyclonal antibody (24379-1-AP)

• 

  WB analysis using 24379-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24379-1-AP (METTL13 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IF Staining of U-251 using 24379-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed U-251 cells using METTL13 antibody (24379-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

METTL13 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 24379-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

CGI 01, EEF1AKNMT, FEAT, KIAA0859, methyltransferase like 13

---

Tested Applications

• Positive WB detected in: 5637 cells
• Positive IF/ICC detected in: U-251 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24379-1-AP targets METTL13 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19355

  Product name: Recombinant human METTL13 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 541-642 aa of BC029083

  Sequence: QSDRMKVHIADGLDYIASLAGGGEARPCYDVIMFDVDSKDPTLGMSCPPPAFVEQSFLQKVKSILTPEGVFILNLVCRDLGLKDSVLAGLKAVFPLLYVRRI

• Full Name: methyltransferase like 13
• Calculated Molecular Weight: 699 aa, 79 kDa
• Observed Molecular Weight: 72-78 kDa
• GenBank Accession Number: BC029083
• Gene Symbol: METTL13
• Gene ID (NCBI): 51603
• RRID: AB_3742110
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N6R0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Protein methyltransferase like 13 (METTL13), also called FEAT, is coded by gene METTL13, which is located at chromosome 1q24.3. Purified from rat livers in 2011 by a Japanese researcher, METTL13 was found to be abnormally overexpressed in several human cancers including lung cancer and to drive tumorigenesis in transgenic mice. A study indicated that METTL13 inhibits apoptosis of lung, breast and liver cancer cells and miR-16 can repress the expression of METTL13 by binding to its 3′-untranslated region. (PMID: 33985542)