METTL17 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• METTL17 Polyclonal antibody, PBS Only (20890-1-PBS)

• 

  IHC staining of mouse colon using 20890-1-AP (same clone as 20890-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 20890-1-AP (METT11D1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20890-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse colon using 20890-1-AP (same clone as 20890-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 20890-1-AP (METT11D1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20890-1-PBS in a different storage buffer formulation.

METTL17 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 20890-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

METT11D1, False p73 target gene protein, Methyltransferase 11 domain-containing protein 1, Methyltransferase-like protein 17, Ribosome assembly protein METTL17, mitochondrial

---

Product Information

20890-1-PBS targets METTL17 in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14518

  Product name: Recombinant human METT11D1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-351 aa of BC005053

  Sequence: MAAALKCLLTLGRWCPGLGVAPQARALAALVPGVTQVDNKSGFLQKRPHRQHPGILKLPHVRLPQALANGAQLLLLGSAGPTMENQVQTLTSYLWSRHLPVEPEELQRRARHLEKKFLENPDLSQTEEKLRGAVLHALRKTTYHWQELSYTEGLSLVYMAARLDGGFAAVSRAFHEIRARNPAFQPQTLMDFGSGTGSVTWAAHSIWGQSLREYMCVDRSAAMLVLAEKLLKGGSESGEPYIPGVFFRQFLPVSPKVQFDVVVSAFSLSELPSKADRTEVVQTLWRKTGHFLVLVENGTKAGHSLLMDARDLVLKGKEKSPLDPRPGFVFAPCPHELPCPQLTNLACSFSQ

• Full Name: methyltransferase 11 domain containing 1
• Calculated Molecular Weight: 478 aa, 53 kDa
• GenBank Accession Number: BC005053
• Gene Symbol: METT11D1
• Gene ID (NCBI): 64745
• RRID: AB_3742007
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H7H0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

METTL17 is located in mitochondria through its N-terminal targeting sequence and specifically interacts with 12S mitochondrial ribosomal RNA (mt-rRNA) as well as small subunits of mitochondrial ribosome (MSSUs). METTL17, a regulator of mitochondrial ribosomal RNA modifications, is required for the translation of mitochondrial coding genes. (PMID: 38377789, PMID: 31487196)