CoraLite® Plus 488-conjugated METTL6 Recombinant monoclonal antibody

METTL6 Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-84209-5
Clone No.241482F9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

241482F9, EC:2.1.1.-, hMETTL6, methyltransferase like 6, Methyltransferase-like protein 6

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84209-5 targets METTL6 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9714

Product name: Recombinant human METTL6 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-250 aa of BC022400

Sequence: MASLQRKGLQARILTSEEEEKLKRDQTLVSDFKQQKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSCREFEDQKLTMLEAGCGVGNCLFPLLEEDPNIFAYACDFSPRAIEYVKQNPLYDTERCKVFQCDLTKDDLLDHVPPESVDVVMLIFVLSAVHPDKMHLVLQNIYKVLKPGKSVLFRDYGLYDHAMLRFKASSKLGENFYVRQDGTRSYFFTDDFLAQLFMDTGYEEVVNEYVFRETVN

Predict reactive species
Full Name methyltransferase like 6
Calculated Molecular Weight 255 aa, 30 kDa
GenBank Accession NumberBC022400
Gene Symbol METTL6
Gene ID (NCBI) 131965
RRIDAB_3673348
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8TCB7
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Methyltransferase-like protein 6 (METTL6) belongs to the METL family. METTL6 is as a crucial regulator of tumor cell growth, and METTL6 is a bona fide transfer RNA (tRNA) methyltransferase, catalyzing the formation of 3-methylcytidine at C32 of specific serine tRNA isoacceptors (PMID:32923617). METTL6 is a member of the RNA methyltransferase family that has been identified in many cancers. The mRNA expression levels of METTL6 were significantly upregulated in HCC tumor tissues compared to that in adjacent non tumor tissues. CRISPR/Cas9 mediated knockout of METTL6 in hepatocellular carcinoma cell lines remarkably inhibited colony formation, cell proliferation, cell migration, cell invasion and cell attachment ability (PMID:34913069).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 METTL6 antibody CL488-84209-5Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...