Filter: AllWBIHC

WB analysis using 67905-1-Ig (same clone as 67905-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 67905-1-Ig (METTL7A antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67905-1-PBS in a different storage buffer formulation.
WB analysis using 67905-1-Ig (same clone as 67905-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 67905-1-Ig (METTL7A antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67905-1-PBS in a different storage buffer formulation.
WB analysis of HepG2 using 67905-1-Ig (same clone as 67905-1-PBS)
WB result of METTL7A antibody (67905-1-Ig; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-METTL7A transfected HepG2 cells. This data was developed using the same antibody clone with 67905-1-PBS in a different storage buffer formulation.
WB analysis of mouse lung using 67905-1-Ig (same clone as 67905-1-PBS)
mouse lung tissue were subjected to SDS PAGE followed by western blot with 67905-1-Ig (METTL7A antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67905-1-PBS in a different storage buffer formulation.
IHC staining of human thyroid cancer using 67905-1-Ig (same clone as 67905-1-PBS)
Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 67905-1-Ig (METTL7A antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67905-1-PBS in a different storage buffer formulation.
IHC staining of human thyroid cancer using 67905-1-Ig (same clone as 67905-1-PBS)
Immunohistochemical analysis of paraffin-embedded human thyroid cancer tissue slide using 67905-1-Ig (METTL7A antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67905-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 67905-1-Ig (same clone as 67905-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67905-1-Ig (METTL7A antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67905-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 67905-1-Ig (same clone as 67905-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67905-1-Ig (METTL7A antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67905-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 67905-1-Ig (same clone as 67905-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67905-1-Ig (METTL7A antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67905-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 67905-1-Ig (same clone as 67905-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67905-1-Ig (METTL7A antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67905-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

METTL7A Monoclonal antibody, PBS Only

METTL7A Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67905-1-PBS

Clone No.1A9B4

Review Product

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, rabbit

Applications

WB, IHC, Indirect ELISA

Synonyms

AAM B, EC:2.1.1.348, EC:2.1.1.9, methyltransferase like 7A, Methyltransferase-like protein 7A

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

67905-1-PBS targets METTL7A in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat, rabbit samples.

Tested Reactivity	human, mouse, rat, rabbit
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag29986 Product name: Recombinant human METTL7A protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-244 aa of BC008180 Sequence: MELTIFILRLAIYILTFPLYLLNFLGLWSWICKKWFPYFLVRFTVIYNEQMASKKRELFSNLQEFAGPSGKLSLLEVGCGTGANFKFYPPGCRVTCIDPNPNFEKFLIKSIAENRHLQFERFVVAAGENMHQVADGSVDVVVCTLVLCSVKNQERILREVCRVLRPGGAFYFMEHVAAECSTWNYFWQQVLDPAWHLLFDGCNLTRESWKALERASFSKLKLQHIQAPLSWELVRPHIYGYAVK Predict reactive species
Full Name	methyltransferase like 7A
Calculated Molecular Weight	28 kDa
Observed Molecular Weight	28 kDa
GenBank Accession Number	BC008180
Gene Symbol	METTL7A
Gene ID (NCBI)	25840
RRID	AB_2918661
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q9H8H3
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

methyltransferase like 7A (METTL7A) is a 244 amino acid protein which belongs to the methyltransferase super family. Methyltransferase can transfer a methyl group from a donor to an acceptor. Methylation may be linked to cancer development as methylation of tumor suppressor genes promotes tumorgenesis and metastasis.