METTL9 Polyclonal antibody

• 

  WB analysis using 15120-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15120-1-AP (METTL9 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 15120-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15120-1-AP (METTL9 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 15120-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15120-1-AP (METTL9 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 15120-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15120-1-AP (METTL9 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human liver cancer using 15120-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15120-1-AP (METTL9 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of HepG2 using 15120-1-AP

  Immunofluorescent analysis of HepG2 cells using 15120-1-AP (METTL9 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

METTL9 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 15120-1-AP

Publications(2)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CGI 81, CGI81, CGI-81, DREV, DREV1

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below
• IHC: See 1 publications below

Product Information

15120-1-AP targets METTL9 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7191

  Product name: Recombinant human METTL9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 36-318 aa of BC000195

  Sequence: MTSGPGGPAAAAGGRKENHQWYVCNREKLCESLQAVFVQSYLDQGTQIFLNNSIEKSGWLFIQLYHSFVSSVFSLFMSRTSINGLLGRGSMFVFSPDQFQRLLKINPDWKTHRLLDLGAGDGEVTKIMSPHFEEIYATELSETMIWQLQKKKYRVLGINEWQNTGFQYDVISCLNLLDRCDQPLTLLKDIRSVLEPTRGRVILALVLPFHPYVENVGGKWEKPSEILEIKGQNWEEQVNSLPEVFRKAGFVIEAFTRLPYLCEGDMYNDYYVLDDAVFVLKPV

• Full Name: methyltransferase like 9
• Calculated Molecular Weight: 37 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC000195
• Gene Symbol: METTL9
• Gene ID (NCBI): 51108
• RRID: AB_2878109
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H1A3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

METTL9 is a broad-specificity methyltransferase that mediates the formation of the majority of 1-methylhistidine(1MH) present in mouse and human proteomes.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Biochem Biophys Rep; Elevated METTL9 is associated with peritoneal dissemination in human scirrhous gastric cancers.; Authors - Toshifumi Hara ; KD Validated
human	WB,IHC	Cell Death Discov; METTL9-SLC7A11 axis promotes hepatocellular carcinoma progression through ferroptosis inhibition; Authors - Fangfang Bi

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Zhongwen (Verified Customer) (09-25-2023)

Low quality, cannot find the target band.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000

METTL9 Antibody Western Blot validation (1:1000 dilution) in (Cat no:15120-1-AP)