MEX3B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MEX3B Polyclonal antibody, PBS Only (30185-1-PBS)

• 

  WB analysis using 30185-1-AP (same clone as 30185-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30185-1-AP (MEX3B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30185-1-PBS in a different storage buffer formulation.

• 

  WB analysis of C2C12 using 30185-1-AP (same clone as 30185-1-PBS)

  C2C12 cells were subjected to SDS PAGE followed by western blot with 30185-1-AP (MEX3B antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30185-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SGC-7901 using 30185-1-AP (same clone as 30185-1-PBS)

  SGC-7901 cells were subjected to SDS PAGE followed by western blot with 30185-1-AP (MEX3B antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30185-1-PBS in a different storage buffer formulation.

MEX3B Polyclonal Antibody for WB, Indirect ELISA

Cat No. 30185-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

MEX 3B, RING finger and KH domain-containing protein 3, RKHD3, RNA-binding protein MEX3B, RNF195

---

Product Information

30185-1-PBS targets MEX3B in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32899

  Product name: Recombinant human MEX3B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 300-458 aa of BC036211

  Sequence: YFGGGTSSSAAATQRLADYSPPSPALSFAHNGNNNNNGNGYTYTAGGEASVPSPDGCPELQPTFDPAPAPPPGAPLIWAQFERSPGGGPAAPVSSSCSSSASSSASSSSVVFPGSGASAPSNANLGLLVHRRLHPGTSCPRLSPPLHMAPGAGEHHLAR

• Full Name: mex-3 homolog B (C. elegans)
• Calculated Molecular Weight: 569 aa, 59 kDa
• Observed Molecular Weight: 60-70 kDa
• GenBank Accession Number: BC036211
• Gene Symbol: MEX3B
• Gene ID (NCBI): 84206
• RRID: AB_3742329
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6ZN04
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Human MEX3B (hMEX3B) protein is an RNA-binding protein that contains two KH domains at the N-terminus and a RING domain at its C-terminus, which has the activity of E3 ubiquitin ligase and is essential for RNA degradation.