MFF Monoclonal antibody, PBS Only

• 

  WB analysis of pig brain using 66527-1-Ig (same clone as 66527-1-PBS)

  pig/rat/mouse brain tissues were subjected to SDS PAGE followed by western blot with 66527-1-Ig (MFF antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66527-1-PBS in a different storage buffer formulation.

• 

  WB analysis of L02 using 66527-1-Ig (same clone as 66527-1-PBS)

  L02 cells were subjected to SDS PAGE followed by western blot with 66527-1-Ig (MFF antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66527-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 66527-1-Ig (same clone as 66527-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 66527-1-Ig (MFF antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66527-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 66527-1-Ig (same clone as 66527-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66527-1-Ig (MFF antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66527-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 66527-1-Ig (same clone as 66527-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66527-1-Ig (MFF antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66527-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 66527-1-Ig (same clone as 66527-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using MFF antibody (66527-1-Ig, Clone: 1G4B12 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66527-1-PBS in a different storage buffer formulation.

MFF Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 66527-1-PBS

Clone No.1G4B12

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

1G4B12, AD033, C2orf33, GL004, Mitochondrial fission factor

---

Product Information

66527-1-PBS targets MFF in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9990

  Product name: Recombinant human MFF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-238 aa of BC000797

  Sequence: MAEISRIQYEMEYTEGISQRMRVPEKLKVAPPNADLEQGFQEGVPNASVIMQVPERIVVAGNNEDVSFSRPADLDLIQSTPFKPLALKTPPRVLTLSERPLDFLDLERPPTTPQNEEIRAVGRLKRERSMSENAVRQNGQLVRNDSLPVLRGGSAAATSNPHHDNVRYGISNIDTTIEGTSDDLTVVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLWFRR

• Full Name: mitochondrial fission factor
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 35-38 kDa
• GenBank Accession Number: BC000797
• Gene Symbol: MFF
• Gene ID (NCBI): 56947
• RRID: AB_2881890
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9GZY8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MFF (mitochondrial fission factor) is a mitochondrial outer membrane protein that is involved in mitochondrial localization of Drp1 and mitochondrial fission. Multiple isoforms of MFF exist due to the alternative splicing. This antibody recognizes the endogenous MFF protein around 26-29 kDa and 35-38 kDa.