MFG-E8 Monoclonal antibody, PBS Only

• 

  WB analysis of human milk using 67797-1-Ig (same clone as 67797-1-PBS)

  human milk were subjected to SDS PAGE followed by western blot with 67797-1-Ig (MFG-E8 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67797-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 67797-1-Ig (same clone as 67797-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 67797-1-Ig (MFG-E8 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67797-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 67797-1-Ig (same clone as 67797-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 67797-1-Ig (MFG-E8 antibody) at dilution of 1:8000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67797-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 67797-1-Ig (same clone as 67797-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 67797-1-Ig (MFG-E8 antibody) at dilution of 1:8000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67797-1-PBS in a different storage buffer formulation.

MFG-E8 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67797-1-PBS

Clone No.1A1A9

Host / Isotype

Mouse / IgG2b

Reactivity

Human

Applications

WB, IHC, Indirect ELISA

Synonyms

BA46, Breast epithelial antigen BA46, EDIL1, HMFG, hP47, HsT19888, Lactadherin, MFG E8, MFGE8, MFG-E8, MFGM, Milk fat globule EGF factor 8, OAcGD3S, SED1, SPAG10

---

Product Information

67797-1-PBS targets MFG-E8 in WB, IHC, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30666

  Product name: Recombinant human MFGE8 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 24-335 aa of BC003610

  Sequence: LDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKCVEPLGMENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLELLGC

• Full Name: milk fat globule-EGF factor 8 protein
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 43 kDa
• GenBank Accession Number: BC003610
• Gene Symbol: MFGE8
• Gene ID (NCBI): 4240
• RRID: AB_2918561
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q08431
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Milk fat globule-epidermal growth factor-factor 8 (MFG-E8), also known as lactadherin, is a multifunctional secreted glycoprotein exhibiting versatile functions in cell physiology affecting health and diseases. It plays roles in clearance of apoptotic cells, anti-inflammatory, wound healing, arterial remodeling, angiogenesis, enhancing tumorigenicity and cancer metastasis (PMID: 23972256). MFG-E8 consists of two-repeated EGF-likedomains, a mucin-like domain and two-repeated discoidin-like domains (C-domains), and contains an integrin-binding motif (RGD sequence) in the EGF-like domain (PMID: 11856354). It shows ubiquitous pattern of expression in various types of cells and tissues. Altered expression of MFG-E8 causes disruptions of homeostasis and is correlated with a number of diseases (PMID: 27429513).