Use Able AI chat for product recommendations
  • KD/KO Validated

MFG-E8 Monoclonal antibody

MFG-E8 Monoclonal Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 67797-1-Ig
Clone No.1A1A9

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IHC, FC (Intra), ELISA

MFGE8, 1A1A9, BA46, Breast epithelial antigen BA46, EDIL1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman milk, human placenta tissue, A549 cells
Positive IHC detected inhuman placenta tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:4000-1:16000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67797-1-Ig targets MFG-E8 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30666

Product name: Recombinant human MFGE8 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 24-335 aa of BC003610

Sequence: LDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKCVEPLGMENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLELLGC

Predict reactive species
Full Name milk fat globule-EGF factor 8 protein
Calculated Molecular Weight 43 kDa
Observed Molecular Weight43 kDa
GenBank Accession NumberBC003610
Gene Symbol MFGE8
Gene ID (NCBI) 4240
RRIDAB_2918561
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ08431
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Milk fat globule-epidermal growth factor-factor 8 (MFG-E8), also known as lactadherin, is a multifunctional secreted glycoprotein exhibiting versatile functions in cell physiology affecting health and diseases. It plays roles in clearance of apoptotic cells, anti-inflammatory, wound healing, arterial remodeling, angiogenesis, enhancing tumorigenicity and cancer metastasis (PMID: 23972256). MFG-E8 consists of two-repeated EGF-likedomains, a mucin-like domain and two-repeated discoidin-like domains (C-domains), and contains an integrin-binding motif (RGD sequence) in the EGF-like domain (PMID: 11856354). It shows ubiquitous pattern of expression in various types of cells and tissues. Altered expression of MFG-E8 causes disruptions of homeostasis and is correlated with a number of diseases (PMID: 27429513).

Protocols

Product Specific Protocols
FC protocol for MFG-E8 antibody 67797-1-IgDownload protocol
IHC protocol for MFG-E8 antibody 67797-1-IgDownload protocol
WB protocol for MFG-E8 antibody 67797-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Invest Ophthalmol Vis Sci

Efferocytosis by Macrophages Attenuates Inflammatory Responses Following Ultraviolet B-Induced Apoptosis in Corneal Stromal Cells.

Authors - Seung Hyeun Lee
humanWB

mBio

Soluble MFGE8 mediates cell entry of Crimean-Congo hemorrhagic fever virus.

Authors - Xue Ma
  • KO Validated
humanWB

Pharmaceuticals (Basel)

Solanum lyratum-Derived Solalyraine A1 Suppresses Non-Small Cell Lung Cancer Through Regulation of Exosome Secretion and Related Protein Biomarkers.

Authors - Pu Jiang
humanWB

Stem Cell Res Ther

Extracellular vesicle bioactivity and potential for clinical development are determined by mesenchymal stromal cell clonal subtype.

Authors - Savvas Ioannou
Loading...
||
New chat

Able

正在加载,请稍候...