CoraLite® Plus 647-conjugated MFGE8 Monoclonal antibody

MFGE8 Monoclonal Antibody for
Cat No. CL647-67797
Clone No.1A1A9

Host / Isotype

Mouse / IgG2b

Reactivity

Human

Applications

BA46, Breast epithelial antigen BA46, EDIL1, HMFG, hP47, HsT19888, Lactadherin, MFG E8, MFGE8, MFGM, Milk fat globule EGF factor 8, OAcGD3S, SED1, SPAG10

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

CL647-67797 targets MFGE8 in applications and shows reactivity with Human samples.

Tested Reactivity Human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag30666

Product name: Recombinant human MFGE8 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 24-335 aa of BC003610

Sequence: LDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKCVEPLGMENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLELLGC

Predict reactive species
Full Name milk fat globule-EGF factor 8 protein
Calculated Molecular Weight 43 kDa
Observed Molecular Weight43 kDa
GenBank Accession NumberBC003610
Gene Symbol MFGE8
Gene ID (NCBI) 4240
RRIDAB_2935086
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ08431
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Milk fat globule-epidermal growth factor-factor 8 (MFG-E8), also known as lactadherin, is a multifunctional secreted glycoprotein exhibiting versatile functions in cell physiology affecting health and diseases. It plays roles in clearance of apoptotic cells, anti-inflammatory, wound healing, arterial remodeling, angiogenesis, enhancing tumorigenicity and cancer metastasis (PMID: 23972256). MFG-E8 consists of two-repeated EGF-likedomains, a mucin-like domain and two-repeated discoidin-like domains (C-domains), and contains an integrin-binding motif (RGD sequence) in the EGF-like domain (PMID: 11856354). It shows ubiquitous pattern of expression in various types of cells and tissues. Altered expression of MFG-E8 causes disruptions of homeostasis and is correlated with a number of diseases (PMID: 27429513).

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 MFGE8 antibody CL647-67797Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...