MGAT2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85933-1-RR (same clone as 85933-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85933-1-RR (MGAT2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85933-1-PBS in a different storage buffer formulation.

• 

  IF Staining of Raji using 85933-1-RR (same clone as 85933-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed Raji cells using MGAT2 antibody (85933-1-RR, Clone: 250147B1 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 85933-1-PBS in a different storage buffer formulation.

MGAT2 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 85933-1-PBS

Clone No.250147B1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase, Beta-1,2-N-acetylglucosaminyltransferase II, CDGS2, EC:2.4.1.143, GlcNAc T II

---

Product Information

85933-1-PBS targets MGAT2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag8423

  Product name: Recombinant human MGAT2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 101-447 aa of BC006390

  Sequence: DQTLRNVDKAGTWAPRELVLVVQVHNRPEYLRLLLDSLRKAQGIDNVLVIFSHDFWSTEINQLIAGVNFCPVLQVFFPFSIQLYPNEFPGSDPRDCPRDLPKNAALKLGCINAEYPDSFGHYREAKFSQTKHHWWWKLHFVWERVKILRDYAGLILFLEEDHYLAPDFYHVFKKMWKLKQQECPECDVLSLGTYSASRSFYGMADKVDVKTWKSTEHNMGLALTRNAYQKLIECTDTFCTYDDYNWDWTLQYLTVSCLPKFWKVLVPQIPRIFHAGDCGMHHKKTCRPSTQSAQIESLLNNNKQYMFPETLTISEKFTVVAISPPRKNGGWGDIRDHELCKSYRRLQ

• Full Name: mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase
• Calculated Molecular Weight: 447 aa, 52 kDa
• Observed Molecular Weight: 55-60 kDa
• GenBank Accession Number: BC006390
• Gene Symbol: MGAT2
• Gene ID (NCBI): 4247
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q10469
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MGAT2 (Monoacylglycerol O-Acyltransferase 2) is a key enzyme in dietary fat absorption, catalyzing the rate-limiting step of monoacylglycerol (MAG) pathway for triacylglycerol (TAG) resynthesis in intestinal enterocytes. It plays a critical role in postprandial lipid metabolism by facilitating the re-esterification of absorbed fatty acids and monoacylglycerols into chylomicron-TAG for lymphatic transport. MGAT2 deficiency or pharmacological inhibition reduces fat absorption, lowers postprandial triglyceridemia, and protects against diet-induced obesity, hepatic steatosis, and insulin resistance in preclinical models. MGAT2 has emerged as a promising therapeutic target for metabolic diseases including obesity, type 2 diabetes, and non-alcoholic fatty liver disease (NAFLD).