MICA Monoclonal antibody

• Home
• Products
• Primary Antibodies
• MICA Monoclonal antibody (66384-1-Ig)

MICA Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66384-1-Ig Copied!

Clone No. 1E2C8

Publications (7)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

1E2C8, MIC A, MIC-A

• 

  WB analysis using 66384-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66384-1-Ig (MICA antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Raji using 66384-1-Ig

  Raji cells were subjected to SDS PAGE followed by western blot with 66384-1-Ig (MICA Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 66384-1-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66384-1-Ig (MICA Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 66384-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 66384-1-Ig (MICA Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Daudi using 66384-1-Ig

  Daudi cells were subjected to SDS PAGE followed by western blot with 66384-1-Ig (MICA Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 66384-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66384-1-Ig (MICA Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 66384-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66384-1-Ig (MICA Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 66384-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 66384-1-Ig (MICA Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 66384-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 66384-1-Ig (MICA Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MICA in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HaCaT cells, Daudi cells, Raji cells, Jurkat cells, HeLa cells, A431 cells
• Positive IHC detected in: human tonsillitis tissue, human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66384-1-Ig targets MICA in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3298

  Product name: Recombinant human MICA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 36-383 aa of BC016929

  Sequence: SWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQTFHVSAVAAAAIFVIIIFYVRCCKKKTSAAEGPELVSLQVLDQHPVGTSDHRDATQLGFQPLMSDLGSTGSTEGT

• Full Name: MHC class I polypeptide-related sequence A
• Calculated Molecular Weight: 383 aa, 43 kDa
• Observed Molecular Weight: 43-50 kDa
• GenBank Accession Number: BC016929
• Gene Symbol: MICA
• Gene ID (NCBI): 100507436
• RRID: AB_2881760
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q29983
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human MHC class I chain-related genes located within the HLA class I region of chromosome 6 encode MHC class I chain-related A and B (MICA and MICB) (PMID: 11429322). MICA and MICB are stress-inducible surface molecules that are not associated with β2-microglobulin and do not present peptides (PMID: 9497295). They are expressed in intestinal epithelium and many epithelial tumors (PMID: 10359807). MICA and MICB are ligands for NKG2D which is an activating receptor that is expressed on most natural killer (NK) cells, CD8 αβ T cells, and γδ T cells (PMID: 10426993, 11491531).

Publications

What published studies show

The MICA Monoclonal antibody (Cat# 66384-1-Ig) has 7 citations. These appear in Pharmacological Research, Cancer Letters, Phytomedicine, Clinical and Translational Medicine, Frontiers in Immunology, Cancers (Basel), and Clinical Proteomics. The research fields span NK cell-mediated tumor immune surveillance, tumor immune escape mechanisms, gastric and breast cancer, colorectal cancer, hepatocellular carcinoma, and alopecia areata. Applications include WB, IHC, and IF.

Automatically generated from the 7 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Pharmacol Res; IDO1 can impair NK cells function against non-small cell lung cancer by downregulation of NKG2D Ligand via ADAM10.; Authors - Xin Fang
human	WB,IHC,IF	Cancer Lett; Pleckstrin-2 promotes tumour immune escape from NK cells by activating the MT1-MMP-MICA signalling axis in gastric cancer; Authors - Deli Mao
mouse,human	WB,IF	Phytomedicine; Ginsenoside Rh2 enhances immune surveillance of natural killer (NK) cells via inhibition of ERp5 in breast cancer; Authors - Chunmei Yang
human	WB	Clin Transl Med; Targeting SLC5A2 suppresses colorectal tumour development by enhancing NK cell activity through extracellular vesicle-dependent MICA/B signalling.; Authors - Jun Xiao
human	WB	Front Immunol; A genome-wide shRNA screen uncovers a novel potential ligand for NK cell activating receptors; Authors - Paolo Romania
human	WB,IHC	Cancers (Basel); MICA+ Tumor Cells Modulate Macrophage Phenotype and Function via PPAR/EHHADH-Mediated Fatty Acid Metabolism in Hepatocellular Carcinoma (HCC); Authors - Jingquan Huang