MICA Monoclonal antibody, PBS Only

• 

  WB analysis using 66384-1-Ig (same clone as 66384-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66384-1-Ig (MICA antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66384-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Raji using 66384-1-Ig (same clone as 66384-1-PBS)

  Raji cells were subjected to SDS PAGE followed by western blot with 66384-1-Ig (MICA Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66384-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 66384-1-Ig (same clone as 66384-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66384-1-Ig (MICA Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66384-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66384-1-Ig (same clone as 66384-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66384-1-Ig (MICA Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66384-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Daudi using 66384-1-Ig (same clone as 66384-1-PBS)

  Daudi cells were subjected to SDS PAGE followed by western blot with 66384-1-Ig (MICA Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66384-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 66384-1-Ig (same clone as 66384-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66384-1-Ig (MICA Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66384-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 66384-1-Ig (same clone as 66384-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66384-1-Ig (MICA Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66384-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 66384-1-Ig (same clone as 66384-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 66384-1-Ig (MICA Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 66384-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 66384-1-Ig (same clone as 66384-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 66384-1-Ig (MICA Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 66384-1-PBS in a different storage buffer formulation.

MICA Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 66384-1-PBS

Clone No.1E2C8

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

1E2C8, MIC A, MIC-A

---

Product Information

66384-1-PBS targets MICA in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3298

  Product name: Recombinant human MICA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 36-383 aa of BC016929

  Sequence: SWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQTFHVSAVAAAAIFVIIIFYVRCCKKKTSAAEGPELVSLQVLDQHPVGTSDHRDATQLGFQPLMSDLGSTGSTEGT

• Full Name: MHC class I polypeptide-related sequence A
• Calculated Molecular Weight: 383 aa, 43 kDa
• Observed Molecular Weight: 43-50 kDa
• GenBank Accession Number: BC016929
• Gene Symbol: MICA
• Gene ID (NCBI): 100507436
• RRID: AB_2881760
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q29983
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Human MHC class I chain-related genes located within the HLA class I region of chromosome 6 encode MHC class I chain-related A and B (MICA and MICB) (PMID: 11429322). MICA and MICB are stress-inducible surface molecules that are not associated with β2-microglobulin and do not present peptides (PMID: 9497295). They are expressed in intestinal epithelium and many epithelial tumors (PMID: 10359807). MICA and MICB are ligands for NKG2D which is an activating receptor that is expressed on most natural killer (NK) cells, CD8 αβ T cells, and γδ T cells (PMID: 10426993, 11491531).