MIDN Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MIDN Polyclonal antibody, PBS Only (18939-1-PBS)

• 

  WB analysis using 18939-1-AP (same clone as 18939-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 18939-1-AP (MIDN antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18939-1-PBS in a different storage buffer formulation.

• 

  WB analysis of BxPC-3 using 18939-1-AP (same clone as 18939-1-PBS)

  BxPC-3 cells were subjected to SDS PAGE followed by western blot with 18939-1-AP (MIDN Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18939-1-PBS in a different storage buffer formulation.

• 

  WB analysis of BxPC-3 using 18939-1-AP (same clone as 18939-1-PBS)

  BxPC-3 cells were subjected to SDS PAGE followed by western blot with 18939-1-AP (MIDN Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18939-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

MIDN Polyclonal Antibody for WB, Indirect ELISA

Cat No. 18939-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, Indirect ELISA

Synonyms

Midnolin

---

Product Information

18939-1-PBS targets MIDN in WB, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13492

  Product name: Recombinant human MIDN protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 127-468 aa of BC094778

  Sequence: TQVSDFLSGRSPLTLALRVGDHMMFVQLQLAAQHAPLQHRHVLAAAAAAAAARGDPSIASPVSSPCRPVSSAARVPPVPTSPSPASPSPITAGSFRSHAASTTCPEQMDCSPTASSSASPGASTTSTPGASPAPRSRKPGAVIESFVNHAPGVFSGTFSGTLHPNCQDSSGRPRRDIGTILQILNDLLSATRHYQGMPPSLAQLRCHAQCSPASPAPDLAPRTTSCEKLTAAPSASLLQGQSQIRMCKPPGDRLRQTENRATRCKVERLQLLLQQKRLRRKARRDARGPYHWSPSRKAGRSDSSSSGGGGSPSEASGLGLDFEDSVWKPEANPDIKSEFVVA

• Full Name: midnolin
• Calculated Molecular Weight: 468 aa, 49 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC094778
• Gene Symbol: MIDN
• Gene ID (NCBI): 90007
• RRID: AB_2878569
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q504T8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Midbrain nucleolar protein (midnolin, MIDN) is abundantly expressed in embryonic midbrain and localizes in the nucleus and nucleolus. MIDN mRNA was strongly and abundantly expressed during early developmental stages, and that the expression was not limited to midbrain but also expressed in diverse adult mouse tissues, including heart, spleen, lung, liver, skeletal muscle, kidney and testis.