MIEN1 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• MIEN1 Recombinant monoclonal antibody, PBS Only (87911-1-PBS)

• 

  WB analysis of BT-474 using 87911-1-RR (same clone as 87911-1-PBS)

  BT-474 cells were subjected to SDS PAGE followed by western blot with 87911-1-RR (MIEN1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87911-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 87911-1-RR (same clone as 87911-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87911-1-RR (MIEN1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87911-1-PBS in a different storage buffer formulation.

• 

  Affinity of 87911-1-RR

  Biolayer interferometry (BLI) kinetic assays of 87911-1-RR against Human MIEN1 were performed. The affinity constant is 2.40 nM.

MIEN1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87911-1-PBS

Clone No.252392C9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

C17orf37, C35, HBV XAg-transactivated protein 4, HBV X-transactivated gene 4 protein, Migration and invasion enhancer 1

---

Product Information

87911-1-PBS targets MIEN1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5748

  Product name: Recombinant Human MIEN1 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 2-115 aa of NM_032339.5

  Sequence: SGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL

• Full Name: chromosome 17 open reading frame 37
• Calculated Molecular Weight: 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: NM_032339.5
• Gene Symbol: C17orf37
• Gene ID (NCBI): 84299
• RRID: AB_3745822
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BRT3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MIEN1 (Migration and Invasion Enhancer 1), also known as C17orf37 or RDEP, is a protein-coding gene located in the q12 region of chromosome 17. Through prenylation modification, this protein anchors to the inner side of the cell membrane, promotes actin cytoskeleton rearrangement and membrane ruffling, thereby enhancing the migration and invasion capabilities of tumor cells. MIEN1 is highly expressed in various malignant tumors, including breast cancer, prostate cancer, and lung cancer, and its expression level is closely correlated with tumor metastasis, clinical stage, and poor patient prognosis. Moreover, MIEN1 promotes epithelial-mesenchymal transition (EMT) by regulating signaling pathways such as PI3K/AKT and NF-κB, making it a potential anti-metastatic therapeutic target and prognostic marker.