MIEN1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• MIEN1 Recombinant monoclonal antibody (87911-1-RR)

• 

  WB analysis of BT-474 using 87911-1-RR

  BT-474 cells were subjected to SDS PAGE followed by western blot with 87911-1-RR (MIEN1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 87911-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87911-1-RR (MIEN1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

MIEN1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87911-1-RR

Clone No.252392C9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

C17orf37, C35, HBV XAg-transactivated protein 4, HBV X-transactivated gene 4 protein, Migration and invasion enhancer 1

---

Tested Applications

• Positive WB detected in: T-47D cells, BT-474 cells, MDA-MB-231 cells, DU 145 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87911-1-RR targets MIEN1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5748

  Product name: Recombinant Human MIEN1 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 2-115 aa of NM_032339.5

  Sequence: SGEPGQTSVAPPPEEVEPGSGVRIVVEYCEPCGFEATYLELASAVKEQYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRPPCVIL

• Full Name: chromosome 17 open reading frame 37
• Calculated Molecular Weight: 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: NM_032339.5
• Gene Symbol: C17orf37
• Gene ID (NCBI): 84299
• RRID: AB_3745822
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BRT3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MIEN1 (Migration and Invasion Enhancer 1), also known as C17orf37 or RDEP, is a protein-coding gene located in the q12 region of chromosome 17. Through prenylation modification, this protein anchors to the inner side of the cell membrane, promotes actin cytoskeleton rearrangement and membrane ruffling, thereby enhancing the migration and invasion capabilities of tumor cells. MIEN1 is highly expressed in various malignant tumors, including breast cancer, prostate cancer, and lung cancer, and its expression level is closely correlated with tumor metastasis, clinical stage, and poor patient prognosis. Moreover, MIEN1 promotes epithelial-mesenchymal transition (EMT) by regulating signaling pathways such as PI3K/AKT and NF-κB, making it a potential anti-metastatic therapeutic target and prognostic marker.