MIER2 Recombinant monoclonal antibody, PBS Only (Detector)

MIER2 Uni-rAb® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 84216-1-PBS
Clone No.241458D2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

241458D2, KIAA1193, Mesoderm induction early response protein 2, Mi-er2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84216-1-PBS targets MIER2 as part of a matched antibody pair:

MP01148-1: 84216-2-PBS capture and 84216-1-PBS detection (validated in Cytometric bead array)

MP01148-2: 84216-3-PBS capture and 84216-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag11491

Product name: Recombinant human MIER2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 197-545 aa of BC028203

Sequence: IMVGPQFQADLSNLHLNRHCEKIYENEDQLLWDPSVLPEREVEEFLYRAVKRRWHEMAGPQLPEGEAVKDSEQALYELVKCNFNVEEALRRLRFNVKVIRDGLCAWSEEECRNFEHGFRVHGKNFHLIQANKVRTRSVGECVEYYYLWKKSERYDYFAQQTRLGRRKYVPSGTTDADQDLDGSDPDGPGRPRPEQDTLTGMRTDPLSVDGTAGGLDEPGVASDGLPSSEPGPCSFQQLDESPAVPLSHRPPALADPASYQPAVTAPEPDASPRLAVDFALPKELPLISSHVDLSGDPEETVAPAQVALSVTEFGLIGIGDVNPFLAAHPTCPAPGLHSEPLSHCNVMTC

Predict reactive species
Full Name mesoderm induction early response 1, family member 2
Calculated Molecular Weight 545 aa, 60 kDa
Observed Molecular Weight60 kDa
GenBank Accession NumberBC028203
Gene Symbol MIER2
Gene ID (NCBI) 54531
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8N344
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Mesoderm induction early response 2 (MIER2) is a member of the MIER family of proteins, which is relatively conservative in evolution and includes three members: MIER1, MIER2, and MIER3. The MIER family is known to contribute to histone deacetylase (HDAC) activity and actively participate in histone deacetylation (PMID: 28046085; PMID: 38702028). In renal cell carcinoma, MIER2 represses PGC1A expression by recruiting HDAC1 to deacetylate P53 (PMID: 28046085).

Loading...
||
New chat Able
正在加载,请稍候...