Product Information
29811-1-PBS targets MIGA2/FAM73B in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag30577 Product name: Recombinant human FAM73B protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 62-180 aa of BC009114 Sequence: AHQLKRRRRRKKQVGPEMGGEQLGTVPLPILLARKVPSVKKGYSSRRVQSPSSKSNDTLSGISSIEPSKHSGSSHSVASMMAVNSSSPTAACSGLWDARGMEESLTTSDGNAESLYMQG Predict reactive species |
| Full Name | family with sequence similarity 73, member B |
| Observed Molecular Weight | 65-70 kDa |
| GenBank Accession Number | BC009114 |
| Gene Symbol | MIGA2/FAM73B |
| Gene ID (NCBI) | 84895 |
| RRID | AB_3086170 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q7L4E1 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
MIGA2 (mitoguardin-2) also named as FAM73B, is a mitochondrial protein at contacts with the ER and/or lipid droplets (LDs), and identified as a lipid transporter. MIGA2 localizes to contact sites between mitochondria and the ER or mitochondria and lipid droplets (LDs) (PMID: 36282247). Based on its presence in many tissues, MIGA2 is likely critical for lipid and energy homeostasis in a wide spectrum of cell types (PMID: 31628041).





