MIP Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MIP Polyclonal antibody, PBS Only (17977-1-PBS)

• 

  WB analysis of mouse eye using 17977-1-AP (same clone as 17977-1-PBS)

  mouse eye tissue were subjected to SDS PAGE followed by western blot with 17977-1-AP (MIP antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17977-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse eye using 17977-1-AP (same clone as 17977-1-PBS)

  mouse eye tissue were subjected to SDS PAGE followed by western blot with 17977-1-AP (MIP antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17977-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skeletal muscle using 17977-1-AP (same clone as 17977-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 17977-1-AP (MIP antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17977-1-PBS in a different storage buffer formulation.

MIP Polyclonal Antibody for WB, Indirect ELISA

Cat No. 17977-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

17977-1-PBS targets MIP in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12369

  Product name: Recombinant human MIP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 179-263 aa of BC074913

  Sequence: TGAGMNPARSFAPAILTGNFTNHWVYWVGPIIGGGLGSLLYDFLLFPRLKSISERLSVLKGAKPDVSNGQPEVTGEPVELNTQAL

• Full Name: major intrinsic protein of lens fiber
• Calculated Molecular Weight: 263 aa, 28 kDa
• Observed Molecular Weight: 26-28 kDa
• GenBank Accession Number: BC074913
• Gene Symbol: MIP
• Gene ID (NCBI): 4284
• RRID: AB_10896454
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P30301
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.