MIPEP Polyclonal antibody

• Home
• Products
• Primary Antibodies
• MIPEP Polyclonal antibody (11002-1-AP)

MIPEP Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11002-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

HMIP, MIP, MIPEP

• 

  WB analysis of HepG2 using 11002-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 11002-1-AP (MIPEP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 11002-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 11002-1-AP (MIPEP antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 11002-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 11002-1-AP (MIPEP antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 11002-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer slide using 11002-1-AP (MIPEP Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 11002-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer slide using 11002-1-AP (MIPEP Antibody) at dilution of 1:50.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for MIPEP in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HepG2 cells, MCF-7 cells
• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11002-1-AP targets MIPEP in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1451

  Product name: Recombinant human MIPEP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-357 aa of BC009934

  Sequence: MLCVGRLGGLGARAAALPPRRAGRGSLEAGIRARRVSTSWSPVGAAFNVKPQGSRLDLFGERRGLFGVPELSAPEGFHIAQEKALRKTELLVDRACSTPPGPQTVLIFDELSDSLCRVADLADFVKIAHPEPAFREAAEEACRSIGTMVEKLNTNVDLYQSLQKLLADKKLVDSLDPETRRVAELFMFDFEISGIHLDKEKRKRAVDLNVKILDLSSTFLMGTNFPNKIEKHLLPEHIRRNFTSAGDHIIIDGLHAESPDDLVREAAYKIFLYPNAGQLKCLEELLSSRDLLAKLVGYSTFSHRALQGTIAKNPETVMQFLEKLSDKLSERTLKDFEMIRGMKMKLNPQNSEVMPWD

• Full Name: mitochondrial intermediate peptidase
• Calculated Molecular Weight: 81 kDa
• Observed Molecular Weight: 70-80 kDa
• GenBank Accession Number: BC009934
• Gene Symbol: MIPEP
• Gene ID (NCBI): 4285
• RRID: AB_2235137
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99797
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MIPEP(Mitochondrial intermediate peptidase) is also named as MIP and belongs to the peptidase M3 family. It performs the final step in processing a specific class of nuclear-encoded proteins targeted to the mitochondrial matrix or inner membrane. The enzyme is a monomer of 75 kDa with a transit peptide and about 20% of the fmal MIP preparation consists of equimolar amounts of two peptides of 47 kDa and 28 kDa, which are apparently the products of a single cleavage of the 75 kDa protein. MIP is an independent endopeptidase acting on mitochondrial intermediate proteins as substrates.(PMID:1322290).

Publications

What published studies show

The MIPEP Polyclonal antibody (Cat# 11002-1-AP) has 2 citations. They appear in Clinical Proteomics (2024) and Biochemical and Biophysical Research Communications (2010). The research fields span estrogen receptor-positive breast cancer proliferation and prognosis, as well as mitochondrial intermediate peptidase expression and enzymatic activity detection using FRET substrates.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Clin Proteomics; ESF1 and MIPEP proteins promote estrogen receptor-positive breast cancer proliferation and are associated with patient prognosis; Authors - Qing Yu
human	WB	Biochem Biophys Res Commun; Mitochondrial intermediate peptidase: expression in Escherichia coli and improvement of its enzymatic activity detection with FRET substrates.; Authors - Marcondes Marcelo F MF