MIPEP Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• MIPEP Polyclonal antibody, PBS Only (11002-1-PBS)

• 

  WB analysis of HepG2 using 11002-1-AP (same clone as 11002-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 11002-1-AP (MIPEP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11002-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 11002-1-AP (same clone as 11002-1-PBS)

  MCF7 cells were subjected to SDS PAGE followed by western blot with 11002-1-AP (MIPEP antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11002-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 11002-1-AP (same clone as 11002-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 11002-1-AP (MIPEP antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11002-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 11002-1-AP (same clone as 11002-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer slide using 11002-1-AP (MIPEP Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 11002-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 11002-1-AP (same clone as 11002-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer slide using 11002-1-AP (MIPEP Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 11002-1-PBS in a different storage buffer formulation.

MIPEP Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 11002-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

11002-1-PBS targets MIPEP in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1451

  Product name: Recombinant human MIPEP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-357 aa of BC009934

  Sequence: MLCVGRLGGLGARAAALPPRRAGRGSLEAGIRARRVSTSWSPVGAAFNVKPQGSRLDLFGERRGLFGVPELSAPEGFHIAQEKALRKTELLVDRACSTPPGPQTVLIFDELSDSLCRVADLADFVKIAHPEPAFREAAEEACRSIGTMVEKLNTNVDLYQSLQKLLADKKLVDSLDPETRRVAELFMFDFEISGIHLDKEKRKRAVDLNVKILDLSSTFLMGTNFPNKIEKHLLPEHIRRNFTSAGDHIIIDGLHAESPDDLVREAAYKIFLYPNAGQLKCLEELLSSRDLLAKLVGYSTFSHRALQGTIAKNPETVMQFLEKLSDKLSERTLKDFEMIRGMKMKLNPQNSEVMPWD

• Full Name: mitochondrial intermediate peptidase
• Calculated Molecular Weight: 81 kDa
• Observed Molecular Weight: 70-80 kDa
• GenBank Accession Number: BC009934
• Gene Symbol: MIPEP
• Gene ID (NCBI): 4285
• RRID: AB_2235137
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99797
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

MIPEP(Mitochondrial intermediate peptidase) is also named as MIP and belongs to the peptidase M3 family. It performs the final step in processing a specific class of nuclear-encoded proteins targeted to the mitochondrial matrix or inner membrane. The enzyme is a monomer of 75 kDa with a transit peptide and about 20% of the fmal MIP preparation consists of equimolar amounts of two peptides of 47 kDa and 28 kDa, which are apparently the products of a single cleavage of the 75 kDa protein. MIP is an independent endopeptidase acting on mitochondrial intermediate proteins as substrates.(PMID:1322290).