MIRO2 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• MIRO2 Recombinant monoclonal antibody, PBS Only (88330-1-PBS)

MIRO2 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 88330-1-PBS

Clone No.260828B1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

RHOT2, ARHT2, C16orf39, EC:3.6.5.-, hMiro 2

• 

  WB analysis using 88330-1-RR (same clone as 88330-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 88330-1-RR (MIRO2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88330-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 88330-1-RR (same clone as 88330-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 88330-1-RR (MIRO2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 88330-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 88330-1-RR (same clone as 88330-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using MIRO2 antibody (88330-1-RR, Clone: 260828B1 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 88330-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

88330-1-PBS targets MIRO2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1752

  Product name: Recombinant human RHOT2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 319-618 aa of BC014942

  Sequence: DRDGALSPVELQSLFSVFPAAPWGPELPRTVRTEAGRLPLHGYLCQWTLVTYLDVRSCLGHLGYLGYPTLCEQDQAHAITVTREKRLDQEKGQTQRSVLLCKVVGARGVGKSAFLQAFLGRGLGHQDTREQPPGYAIDTVQVNGQEKYLILCEVGTDGLLATSLDATCDVACLMFDGSDPKSFAHCASVYKHHYMDGQTPCLFVSSKADLPEGVAVSGPSPAEFCRKHRLPAPVPFSCAGPAEPSTTIFTQLATMAAFPHLVHAELHPSSFWLRGLLGVVGAAVAAVLSFSLYRVLVKSQ

• Full Name: ras homolog gene family, member T2
• Calculated Molecular Weight: 68 kDa
• Observed Molecular Weight: 68-75 kDa
• GenBank Accession Number: BC014942
• Gene Symbol: RHOT2
• Gene ID (NCBI): 89941
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8IXI1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RHOT2 (Ras homolog gene family, member T2), also known as ARHT2, RASL or MIRO-2 (mitochondrial Rho GTPase 2), is a 618 amino acid single-pass type IV membrane protein as a member of the Rho family of GTPases. It is localized to the outer mitochondrial membrane and plays a role in mitochondrial trafficking and fusion-fission dynamics. RHOT2 is ubiquitously expressed with highest levels found in pancreas, heart, kidney and skeletal muscle. MIRO2 is highly phosphorylated at basal conditions, as evidenced by an immunoreactive band that electrophoretically migrates 7 kDa higher (~75 kDa) compared to its predicted molecular weight (68 kDa) (PMID: 28556983).