MIRO2 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• MIRO2 Recombinant monoclonal antibody (88330-1-RR)

MIRO2 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 88330-1-RR

Clone No.260828B1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

RHOT2, ARHT2, C16orf39, EC:3.6.5.-, hMiro 2

• 

  WB analysis using 88330-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 88330-1-RR (MIRO2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 88330-1-RR

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 88330-1-RR (MIRO2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 88330-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using MIRO2 antibody (88330-1-RR, Clone: 260828B1 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: LNCaP cells, A549 cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells
• Positive IHC detected in: human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

88330-1-RR targets MIRO2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1752

  Product name: Recombinant human RHOT2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 319-618 aa of BC014942

  Sequence: DRDGALSPVELQSLFSVFPAAPWGPELPRTVRTEAGRLPLHGYLCQWTLVTYLDVRSCLGHLGYLGYPTLCEQDQAHAITVTREKRLDQEKGQTQRSVLLCKVVGARGVGKSAFLQAFLGRGLGHQDTREQPPGYAIDTVQVNGQEKYLILCEVGTDGLLATSLDATCDVACLMFDGSDPKSFAHCASVYKHHYMDGQTPCLFVSSKADLPEGVAVSGPSPAEFCRKHRLPAPVPFSCAGPAEPSTTIFTQLATMAAFPHLVHAELHPSSFWLRGLLGVVGAAVAAVLSFSLYRVLVKSQ

• Full Name: ras homolog gene family, member T2
• Calculated Molecular Weight: 68 kDa
• Observed Molecular Weight: 68-75 kDa
• GenBank Accession Number: BC014942
• Gene Symbol: RHOT2
• Gene ID (NCBI): 89941
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8IXI1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RHOT2 (Ras homolog gene family, member T2), also known as ARHT2, RASL or MIRO-2 (mitochondrial Rho GTPase 2), is a 618 amino acid single-pass type IV membrane protein as a member of the Rho family of GTPases. It is localized to the outer mitochondrial membrane and plays a role in mitochondrial trafficking and fusion-fission dynamics. RHOT2 is ubiquitously expressed with highest levels found in pancreas, heart, kidney and skeletal muscle. MIRO2 is highly phosphorylated at basal conditions, as evidenced by an immunoreactive band that electrophoretically migrates 7 kDa higher (~75 kDa) compared to its predicted molecular weight (68 kDa) (PMID: 28556983).