Use Able AI chat for product recommendations

MITD1 Recombinant monoclonal antibody, PBS Only

MITD1 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA

Cat No. 88031-1-PBS
Clone No.260134F6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

MIT domain-containing protein 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

88031-1-PBS targets MITD1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag10998

Product name: Recombinant human MITD1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-249 aa of BC018453

Sequence: MAKSGLRQDPQSTAAATVLKRAVELDSESRYPQALVCYQEGIDLLLQVLKGTKDNTKRCNLREKISKYMDRAENIKKYLDQEKEDGKYHKQIKIEENATGFSYESLFREYLNETVTEVWIEDPYIRHTHQLYNFLRFCEMLIKRPCKVKTIHLLTSLDEGIEQVQQSRGLQEIEESLRSHGVLLEVQYSSSIHDREIRFNNGWMIKIGRGLDYFKKPQSRFSLGYCDFDLRPCHETTVDIFHKKHTKNI

Predict reactive species
Full Name MIT, microtubule interacting and transport, domain containing 1
Calculated Molecular Weight 249 aa, 29 kDa
Observed Molecular Weight 29 kDa
GenBank Accession NumberBC018453
Gene Symbol MITD1
Gene ID (NCBI) 129531
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8WV92
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

MITD1 (Microtubule Interacting and Trafficking Domain Containing 1) has a molecular weight of approximately 29.3 kDa and consists of 249 amino acids. Functionally, MITD1 regulates ESCRT-III activity and is required for efficient abscission at the end of cytokinesis. It functions as a homodimer, with its N-terminal MIT domain binding to a subset of ESCRT-III subunits and its C-terminal unanticipated phospholipase D-like (PLD) domain binding to membranes. Depletion of MITD1 causes cytokinetic defects, including midbody destabilization and abscission failure. Beyond its role in cell division, MITD1 has recently been identified as a brain-specific interferon-inducible factor that inhibits flavivirus replication.

Loading...
||
New chat

Able

正在加载,请稍候...