MITF Recombinant monoclonal antibody, PBS Only (Detector)

MITF Uni-rAb® Recombinant Antibody for WB, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA
Cat No. 83803-1-PBS
Clone No.240815B4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), Cytometric bead array, Sandwich ELISA, Indirect ELISA

bHLHe32, Class E basic helix-loop-helix protein 32, MI, Microphthalmia-associated transcription factor, WS2A

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83803-1-PBS targets MITF as part of a matched antibody pair:

MP00746-2: 83803-4-PBS capture and 83803-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3679

Product name: Recombinant human MITF protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-91 aa of BC012503

Sequence: MLEMLEYNHYQVQTHLENPTKYHIQQAQRQQVKQYLSTTLANKHANQVLSLPCPNQPGDHVMPPVPGSSAPNSPMAMLTLNSNCEKEFMKQ

Predict reactive species
Full Name microphthalmia-associated transcription factor
Calculated Molecular Weight 91 aa, 10 kDa, 59 kDa
Observed Molecular Weight 60-65 kDa
GenBank Accession NumberBC012503
Gene Symbol MITF
Gene ID (NCBI) 4286
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO75030
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The retinal pigment epithelium (RPE) has a essential role in maintaining visual function and dedifferentiation of RPE contributes to the pathophysiology of several ocular diseases (PMID:22523078). Microphthalmia-associated transcription factor (MITF) is a key regulator of RPE differentiation that is also down-regulated in dedifferentiated hfRPE cells. MITF is a basic helix-loop-helix (hHLH)-leucine zipper protein that involves in the development of various cell types, including neural crest-derived melanocytes and optic cup-derived retinal pigment epithelial cells (PMID: 10578055).

Loading...
||
New chat

Able

正在加载,请稍候...